From owner-freebsd-questions@freebsd.org Sun Jul 14 05:11:18 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id D993B15D8371 for ; Sun, 14 Jul 2019 05:11:17 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 411DB8875A for ; Sun, 14 Jul 2019 05:11:16 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563081072; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=JTCo5Yvw7OAtNEe0Y+Ge7jwakZxEo/peSIiHAy40/dI=; b=KZuW3lX64a01JQwGuzyWpf8/Cjau4hdEcL8oVIM6gGPBRjOmFsNxnyTBeyOpiVXTte 142JzfclOVCLgO310enn1htYOUtoOZZ6BNjp68fH0jBCx/O6FtsifjzjOChR+sT208vd RgTyZr/p9pQ70C/9uqMQUvUn06IOkcOLrlzW5V0elOo7wKPyGnN3re5g/qZJPd2vMVlE LX4B4C4X3gH5q6Zhuwl/w03yjZykiwoenjBkhA3qYaTORY7BT+BN/DZSwg8GQqTLj+EX +QlwO0ZCjCVpRGgKq0flr+sU8YzNTyXd0P0L67+7guXw2vnGnv9oa8C0pI75kG4bMR8M 35FA== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6E5BCQLA (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Sun, 14 Jul 2019 07:11:12 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmWn1-0001pf-GB; Sun, 14 Jul 2019 07:11:11 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmWn1-0000du-0h; Sun, 14 Jul 2019 07:11:11 +0200 From: hw To: "Kevin P. Neal" Cc: "Clay Daniels Jr." , freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: <20190714011303.GA25317@neutralgood.org> (Kevin P. Neal's message of "Sat, 13 Jul 2019 21:13:03 -0400") Date: Sun, 14 Jul 2019 07:10:26 +0200 Message-ID: <87v9w58apd.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 411DB8875A X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=KZuW3lX6 X-Spamd-Result: default: False [-2.92 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.08)[-0.078,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[4.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.74)[ipnet: 2a01:238::/32(-3.27), asn: 6724(-0.40), country: DE(-0.01)]; FREEMAIL_CC(0.00)[gmail.com] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 05:11:18 -0000 "Kevin P. Neal" writes: > On Sat, Jul 13, 2019 at 05:39:51AM +0200, hw wrote: >> ZFS is great when you have JBODs while storage performance is >> irrelevant. I do not have JBODs, and in almost all cases, storage >> performance is relevant. > > Huh? Is a _properly_ _designed_ ZFS setup really slower? A raidz > setup of N drives gets you the performance of roughly 1 drive, but a > mirror gets you the write performance of a titch less than one drive > with the read performance of N drives. How does ZFS hurt performance? Performance is hurt when you have N disks and only get the performance of a single disk from them. Mirroring the N disks would require another N disks, which you don't have. "Performance" isn't much better defined as "properly designed" here. In practise, I prefer a hardware RAID5 with N disks over a raidz with N disks and a RAID10 over a RAID5. Unfortunately, in practise, the number of disks is limited because they aren't cheap and because only so many disks can be connected to a machine without further ado while there is a certain requirement for storage capacity. Reality is not proper designed :/ What do you do when you put FreeBSD on a server that has a hardware RAID controller which doesn't do JBOD? Use ZFS on the RAID? From owner-freebsd-questions@freebsd.org Sun Jul 14 06:50:04 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 7A74415DA42F for ; Sun, 14 Jul 2019 06:50:04 +0000 (UTC) (envelope-from anders@jensenwaud.com) Received: from mail-pl1-x631.google.com (mail-pl1-x631.google.com [IPv6:2607:f8b0:4864:20::631]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id A1E298B897 for ; Sun, 14 Jul 2019 06:50:01 +0000 (UTC) (envelope-from anders@jensenwaud.com) Received: by mail-pl1-x631.google.com with SMTP id b7so6746854pls.6 for ; Sat, 13 Jul 2019 23:50:01 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=jensenwaud-com.20150623.gappssmtp.com; s=20150623; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=cs3/B5hKgeQZzjrErR/8o15s2VGJEkfrVDobGb4HQzw=; b=t420p48NeVMCG+fNi8DrwW7W4PwsPRnwNOWkGLL3MvHBof/+wxXQVaCEUMKNVe2fBh urgpHS+cuirJ1paUPsrQkeCL6gPVpmNPmqEH0KMqtbcVuUaDShiqBVsd+Unhvl7v3Oo6 wwYB5CvMnr4OICztBU6ZDCpi7X6fZQIvQCv2Mgc+aK0aSed9U3zpkclNKFwgpundbTL4 vZLqXf1piWq3BAxZmULdCNvUco+r5CQQgDjMcqBL859sVpLXssUtD7Lwu8Q6MKFCwj8D C7L0BRaxoxIA8RdavXKr043QOLPJXsukccTuirBYSpCjyQ7AXZJozD/FT6u02G+XRUu4 E3/w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=cs3/B5hKgeQZzjrErR/8o15s2VGJEkfrVDobGb4HQzw=; b=hK9ZGB/3mWsHJv6A5blhaQUu7UUuYu8KDIEWBXLulCdmVjF+QszOkceK/oqXqjFvFX zbisdxGinAPpM2n+Lvhta5mZoLnrKUwusXTvQNnShJqx/FlAErrTbt6G0XtgDXvxJUCS VdcJJd7k0TMaDFXu+G7FdY9qxmk56ojoFls9SzbMbKmQ4QpWb5d1OIgtZQwPzpOUk7GT S+rzPCV9xEI9aS7XMrvGM3F6mp76vhEcwxh6zB2gmNX959FE+pghfX36J+QtrnMi80LI LAtn/z3zcqaI6Rfew7dc7LbB3x0GYWCC4TTl/JALeVkGDRmKLk1QOpWtBdKmoIROiH8H 0FLQ== X-Gm-Message-State: APjAAAXdmMIaCi9BCPKnljIc3CbMFd6ZDNG0Kj2CYelWJOlVPN8S4wFy qwNKwsR+QWX5+ENusWtOc9pff6DP X-Google-Smtp-Source: APXvYqzKEdnkCjPuZihL0GSqlqd31iqnvfJl8iP4mU05Z0dAJVipqipW42d8nRsKbImBaAaMMUFrCQ== X-Received: by 2002:a17:902:b497:: with SMTP id y23mr21524266plr.68.1563086999871; Sat, 13 Jul 2019 23:49:59 -0700 (PDT) Received: from kennedy.lan ([59.167.161.86]) by smtp.gmail.com with ESMTPSA id i124sm26072722pfe.61.2019.07.13.23.49.57 (version=TLS1_3 cipher=AEAD-AES128-GCM-SHA256 bits=128/128); Sat, 13 Jul 2019 23:49:59 -0700 (PDT) Subject: Re: How to explore Android device files under FreeBSD ? To: Manish Jain , "freebsd-questions@freebsd.org" References: From: Anders Jensen-Waud Message-ID: <6b6670c9-277b-e874-f82b-dcaa38fa82a4@jensenwaud.com> Date: Sun, 14 Jul 2019 16:49:55 +1000 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-US X-Rspamd-Queue-Id: A1E298B897 X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=jensenwaud-com.20150623.gappssmtp.com header.s=20150623 header.b=t420p48N X-Spamd-Result: default: False [-5.04 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[jensenwaud-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; MX_GOOD(-0.01)[alt1.aspmx.l.google.com,aspmx.l.google.com,aspmx3.googlemail.com,aspmx2.googlemail.com,aspmx5.googlemail.com,alt2.aspmx.l.google.com,aspmx4.googlemail.com]; FREEMAIL_TO(0.00)[hotmail.com]; FROM_EQ_ENVFROM(0.00)[]; IP_SCORE(-2.97)[ip: (-9.16), ipnet: 2607:f8b0::/32(-3.18), asn: 15169(-2.44), country: US(-0.06)]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[jensenwaud-com.20150623.gappssmtp.com:s=20150623]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_SHORT(-0.76)[-0.765,0]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[jensenwaud.com]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[1.3.6.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.b.8.f.7.0.6.2.list.dnswl.org : 127.0.5.0]; R_SPF_NA(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 06:50:04 -0000 On 14/7/19 4:49 am, Manish Jain wrote: > Is there some way I can do that ? > > > My Android phone does not have a USB port, but it does have a micro USB > port (which I use for > > charging the phone). I have used FUSE to download photos from my Android phone connected via a micro-USB to USB cable. Once connected to my FreeBSD box, I enabled MTP and I could use FUSE to access it similar to a digital camera. From memory it was using the package 'fusefs-simple-mtpfs-0.3.0_4'. Best Anders From owner-freebsd-questions@freebsd.org Sun Jul 14 07:01:13 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 05E8D15DA708 for ; Sun, 14 Jul 2019 07:01:13 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from ms-10.1blu.de (ms-10.1blu.de [178.254.4.101]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id C4A208BE0F for ; Sun, 14 Jul 2019 07:01:11 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from [188.174.85.205] (helo=localhost.unixarea.de) by ms-10.1blu.de with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.86_2) (envelope-from ) id 1hmYVK-0003iF-31; Sun, 14 Jul 2019 09:01:02 +0200 Received: from localhost.my.domain (localhost [127.0.0.1]) by localhost.unixarea.de (8.15.2/8.14.9) with ESMTPS id x6E7104Q002505 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 14 Jul 2019 09:01:00 +0200 (CEST) (envelope-from guru@unixarea.de) Received: (from guru@localhost) by localhost.my.domain (8.15.2/8.14.9/Submit) id x6E710ig002504; Sun, 14 Jul 2019 09:01:00 +0200 (CEST) (envelope-from guru@unixarea.de) X-Authentication-Warning: localhost.my.domain: guru set sender to guru@unixarea.de using -f Date: Sun, 14 Jul 2019 09:01:00 +0200 From: Matthias Apitz To: "freebsd-questions@freebsd.org" Cc: Polytropon , Manish Jain Subject: Re: How to explore Android device files under FreeBSD ? Message-ID: <20190714070100.GA2352@c720-r342378> Reply-To: Matthias Apitz Mail-Followup-To: "freebsd-questions@freebsd.org" , Polytropon , Manish Jain References: <20190713224753.f5e51166.freebsd@edvax.de> <20190714011013.ffd240ce.freebsd@edvax.de> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="82I3+IH0IqGh5yIs" Content-Disposition: inline In-Reply-To: <20190714011013.ffd240ce.freebsd@edvax.de> X-Operating-System: FreeBSD 13.0-CURRENT r342378 (amd64) X-message-flag: Mails containing HTML will not be read! Please send only plain text. User-Agent: Mutt/1.11.1 (2018-12-01) X-Con-Id: 51246 X-Con-U: 0-guru X-Originating-IP: 188.174.85.205 X-Rspamd-Queue-Id: C4A208BE0F X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-5.63 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XOIP(0.00)[]; TO_DN_SOME(0.00)[]; HAS_REPLYTO(0.00)[guru@unixarea.de]; IP_SCORE(-2.98)[ip: (-8.73), ipnet: 178.254.0.0/19(-3.52), asn: 42730(-2.65), country: DE(-0.01)]; HAS_XAW(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[mail.unixarea.de]; NEURAL_HAM_SHORT(-0.84)[-0.845,0]; SIGNED_PGP(-2.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[101.4.254.178.list.dnswl.org : 127.0.5.1]; RECEIVED_SPAMHAUS_PBL(0.00)[205.85.174.188.zen.spamhaus.org : 127.0.0.10]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:42730, ipnet:178.254.0.0/19, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; DMARC_NA(0.00)[unixarea.de]; AUTH_NA(1.00)[]; MIME_TRACE(0.00)[0:+,1:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 07:01:13 -0000 --82I3+IH0IqGh5yIs Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable El d=C3=ADa domingo, julio 14, 2019 a las 01:10:13a. m. +0200, Polytropon e= scribi=C3=B3: > On Sat, 13 Jul 2019 22:41:12 +0000, Manish Jain wrote: > > No matter how hard I try, no da0 turns up. >=20 > Does _nothing_ turn up? Maybe you need to enable USB on the > phone first. Check your settings. In some cases, the device > files are being created after a specific interaction on the > phone, i. e., it detects that some USB contact has been > established, and then asks as if USB mass storage or MTP > compatible device is desired; after making that selection, > the appropriate devices are being created according to the > "self-identification" of the phone. There is only one real solution: root the device, install/enable sshd into it, configure the USB port for tethering (i.e. that you can run TCP/IP over USB) or configure the Wifi to ssh into it via Wifi. I use an Ubuntu mobile phone which uses internal an Android kernel and on top of the Ubuntu 16.04. I wrote some hints about some stuff one can do with it, maybe it gives you some ideas for your case: https://gurucubano.gitbooks.io/bq-aquaris-e-4-5-ubuntu-phone/content/en/ But before you must "open" the device, i.e. root it. There are a lot of ins= tructions in Internet about how to do this. matthias --=20 Matthias Apitz, =E2=9C=89 guru@unixarea.de, http://www.unixarea.de/ +49-176= -38902045 Public GnuPG key: http://www.unixarea.de/key.pub May, 9: =D0=A1=D0=BF=D0=B0=D1=81=D0=B8=CC=81=D0=B1=D0=BE =D0=BE=D1=81=D0=B2= =D0=BE=D0=B1=D0=BE=D0=B4=D0=B8=D1=82=D0=B5=D0=BB=D0=B8! Thank you very much= , Russian liberators! --82I3+IH0IqGh5yIs Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEXmn7rBYYViyzy/vBR8z35Hb+nREFAl0q0yUACgkQR8z35Hb+ nRFkQhAAgvuneWumZ86kJtVS+lABocPnyM6Tk79s3CgK6ZXsJdmNP40vGSnCmAAd jsjs9r7EojRMqMJNPftigWdJfH4H4st5N1gRO+lb99qAJLs4O6Mfh2QMxCC9cs3R CJwFfNsG4s0Gmn1vbWs9Um6j5qoy0jW0LtL34kke7+3Gjv7jI0oTnaZf2hIV8j2Q fQS+BlD61kHd8lokijJubaGTCbXfHvimjcBSegCRdvnd+pCLWE610jxHEtAgAIsE ymatebTssWrM9DPuCbYaNUCInMr9ePCo8t/QhurANIHkTk9Wo8+EQqWoAgu9/6gx 5ym+4xUUu9LTI9s2R3tn+Wg/oXi4xOzMoQKF9vbKTyD46vPYjm80+V4p6orjJA8r UGC59aNta2OqMk2pwphg5GZpre7zUwjLepSec+fQtMdJu46t1Cn1mRuBJ/5d74vR C9yeVuq37kCzmj2FF05gPlQp/8zdwKWLBNmSMX/PSm4HdcdR/dvmjmKgTmR0Tczx x3mA/awqCRRhSf9l/l0qMivfbCxSQD5Qws14JSn+Ri+/g+MPes6ZI4MxbaUQbtNz a8Akxvi9RIqz9aTCyb1mPzrV1xdMmJQ80BMSvL4Dh8IvPBpkgcm0gOOeQ/IGtFMM IUg1FT1j8sRtGUaZChlvDYCdveGVEf3m71mXH3qch6SEurctTiQ= =YdZT -----END PGP SIGNATURE----- --82I3+IH0IqGh5yIs-- From owner-freebsd-questions@freebsd.org Sun Jul 14 08:38:18 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 84CF315DC807 for ; Sun, 14 Jul 2019 08:38:18 +0000 (UTC) (envelope-from mail@osfux.nl) Received: from vm1982.osfux.nl (vm1982.osfux.nl [IPv6:2a03:5500:1724:55:79:99:187:212]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 761468EEED for ; Sun, 14 Jul 2019 08:38:15 +0000 (UTC) (envelope-from mail@osfux.nl) Received: from vm1982.osfux.nl (localhost [127.0.0.1]) by vm1982.osfux.nl (Postfix) with ESMTP id 8584520257; Sun, 14 Jul 2019 10:37:50 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=osfux.nl; s=default; t=1563093476; bh=S3CwKId7fuc621kV+IU31fPkRmUZkoV7ApbX8j3bGZU=; h=Subject:To:Cc:References:From:Date:In-Reply-To; b=RYWUlMxwLbBfccRtDffDnWQqRg+kIF6DeeI48bjPOMkdGacRowt+tonu0iTcf2+z/ v85MaqBlyRLAS94dkh5uSWG325b6ecsO42l2Xh1NN/gZZDSpgbGMQh0ZAEIuZ9mcZg 7122VW9pB7vS2Fw4sIj4CwJdX5+iCCnGzlroNjXRTI08L+EAL1f4YMM4scNXvev6Ej ne6NkN4EvmcMzOCD2XaNO5NM8MxJSGbMWTbdCcpIZ0Mcp4xKXhxk9FVPQOiB1aGh3J 1BjIBbx4Oj6TccTfduN2CQGQlxIjSiYNaj5Su+AN8KkcG1xfVP8/xCvqD1aGoOPTQC TJARfGZHO4ZfoFBckxW4IWYzezgSNITgJI22Ax0/iv66r8VeOuez78EY3349qf6WIM f1CpU2w7MbP0G8T4BWdzVBeTOI9/aD5XKfFkRVbduS4FNg5C6Q1fh+7dde4yAk87PZ ztByqwBGFglcx+fe4le0WqBJbvftcIirsPpMxEL49CahmAqFnncdNkVFD+k4/tcxl8 CJKyEUaNoSU+HMcnMdheZCa+fFOBPvreFhlAhP3kh2XXy+865j7J/ZGMYCsoPjf5Wg oxCzPWi2nhcUC/RZGrd59UCobt4tHBvwVZa5I5gElxLplEfjM0duC+JcuA7jFZQg0w dNsH24iOpvUGm8eX9UEba8rM= Received: from vm1982.osfux.nl (localhost [127.0.0.1]) by vm1982.osfux.nl (Postfix) with ESMTP id AF6C9201A9; Sun, 14 Jul 2019 10:37:43 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=osfux.nl; s=default; t=1563093470; bh=S3CwKId7fuc621kV+IU31fPkRmUZkoV7ApbX8j3bGZU=; h=Subject:To:Cc:References:From:Date:In-Reply-To; b=D4mhKu5aoNuu1dLNxLj1CjrNrN5mBCTsTDHGD2U6ez8/yf1nhnuaOX+EjYV6XE7sP UC9jzX6HcLJyw9FrRxqMqf51BMNhWkUSeUrKI/XasFcplYVtSGUNZB17M1T6vI5E39 CBdYZZdhgoCKMCiNG53A2jHShr5gbsiTaUzb2eoISmTH4zl5H66f4NEfl5xYIt2E/h 2hHpGOfBXpy5NgDfjZDcSD5g8heLmtEyAOjPBYJseaclEAmW65rBCm6oRXzG1UDk8Z JFY4oaAvxtpvLetlZBuVwU1K+a/zFakhJyy+fn3Ea9a2lE//u2Ejr7kZ43J9E2U6ud ZF7F1J2fkfb2tUZx+UJ2A1i7OKVkNuh3IHtCX2KvBt3NuhqNNxRhLMgjTN8+RfZ+Am evvQScqMXAbxpHEdLw52ovJrwF6Gc9HIcQr7XNcDpetogBhsD57svXUk4ONhy2CCuM iRVejxADtwyFGUObOf1QEn8N/u2VBAGafYqNPxVS9EStaZabyH2WBAlukpHrZHxBkt ZcMQ2nxZwRuTloqNZRMGZuZDjmdfdaa4/wkYbJ3P+4nIZf7t2PCNoTHY0d3HhLclt9 jlIWnx6jXm3KCUMGJvRXJUSUXnp2lH0ghvjsDJkgvE9U2ZezNvH/r38tJa0HwoTpFL 0xibdPfK95PDtBIJ09+OgeyQ= X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on vm1982.osfux.nl Received: from [192.168.9.78] (ip51ccb320.speed.planet.nl [81.204.179.32]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by vm1982.osfux.nl (Postfix) with ESMTPSA; Sun, 14 Jul 2019 10:37:39 +0200 (CEST) Subject: Re: dead slow update servers To: hw , "Kevin P. Neal" Cc: freebsd-questions@freebsd.org, "Clay Daniels Jr." References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> From: Ruben Message-ID: <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> Date: Sun, 14 Jul 2019 10:37:51 +0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.7.2 MIME-Version: 1.0 In-Reply-To: <87v9w58apd.fsf@toy.adminart.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Virus-Scanned: ClamAV using ClamSMTP X-Rspamd-Queue-Id: 761468EEED X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=osfux.nl header.s=default header.b=RYWUlMxw; dkim=pass header.d=osfux.nl header.s=default header.b=D4mhKu5a; dmarc=pass (policy=none) header.from=osfux.nl; spf=pass (mx1.freebsd.org: domain of mail@osfux.nl designates 2a03:5500:1724:55:79:99:187:212 as permitted sender) smtp.mailfrom=mail@osfux.nl X-Spamd-Result: default: False [-2.05 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[osfux.nl:s=default]; NEURAL_HAM_MEDIUM(-1.00)[-0.996,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_SOME(0.00)[]; NEURAL_SPAM_SHORT(0.97)[0.969,0]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[osfux.nl:+]; DMARC_POLICY_ALLOW(-0.50)[osfux.nl,none]; MX_GOOD(-0.01)[transip.osfux.nl,vm1982.osfux.nl]; IP_SCORE(-0.02)[asn: 34762(-0.07), country: BE(-0.00)]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:34762, ipnet:2a03:5500::/31, country:BE]; MID_RHS_MATCH_FROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 08:38:18 -0000 On 7/14/19 7:10 AM, hw wrote: > "Kevin P. Neal" writes: stuff snipped > > What do you do when you put FreeBSD on a server that has a hardware RAID > controller which doesn't do JBOD? Use ZFS on the RAID? I've created rock-solid setups over the years where you just create 6 raid0 arrays and have zfs use those 6 raid0 arrays for a raidz2 zpool. I've created a bunch of buggy zpools that way as well, kind of depends on the raid controller i guess. You can get second hand raid controllers that have been flashed with JBOD firmware from https://www.ebay.nl/usr/theartofserver Those raidcontrollers are great for running FreeBSD and the guy posts lots of interesting videos on youtube and is very responsive in support requests as well. I'd always use JBOD for ZFS. If it doesn't, try to reflash or just ditch the raid-controller if it doesn't support it (and get a "proper" one). Kind regards, ruben From owner-freebsd-questions@freebsd.org Sun Jul 14 09:18:00 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id B182415DD671 for ; Sun, 14 Jul 2019 09:18:00 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id B82BC68395 for ; Sun, 14 Jul 2019 09:17:59 +0000 (UTC) (envelope-from kremels@kreme.com) From: "@lbutlr" Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Subject: Re: pkg query timestamp format Date: Sun, 14 Jul 2019 03:17:57 -0600 References: <5D28CD7B.40102@webtent.org> <5343D197-AF3A-490E-AB75-F0624A77A3FE@kreme.com> <20190713202207.4e7f827e.freebsd@edvax.de> To: freebsd-questions@freebsd.org In-Reply-To: <20190713202207.4e7f827e.freebsd@edvax.de> Message-Id: <94704E03-AE5F-458A-89B5-F35D977452C3@kreme.com> X-Mailer: Apple Mail (2.3445.104.11) X-Rspamd-Queue-Id: B82BC68395 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [-0.40 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.55)[-0.554,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MISSING_MIME_VERSION(2.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-0.91)[-0.914,0]; IP_SCORE(-0.26)[ip: (-0.90), ipnet: 65.112.0.0/12(-0.32), asn: 209(-0.01), country: US(-0.06)]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MX_GOOD(-0.01)[mail.covisp.net]; NEURAL_HAM_SHORT(-0.27)[-0.269,0]; RCVD_COUNT_ZERO(0.00)[0]; RCVD_IN_DNSWL_LOW(-0.10)[42.55.121.65.list.dnswl.org : 127.0.5.1]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 09:18:00 -0000 On 13 Jul 2019, at 12:22, Polytropon wrote: > On Sat, 13 Jul 2019 03:31:17 -0600, @lbutlr wrote: >> On 12 Jul 2019, at 18:30, David Christensen = wrote: >>> $ pkg query %n-%t | perl -ne '/(.+)-(\d+)$/; ($d,$m,$y)=3D(localtime = $2)[3,4,5];$y+=3D1900; printf "%-50s %4i-%02i-%02i\n", $1, $y, $m ,$d=E2=80= =99 >> I tried to add a | sort -k 2, thinking that would sort the output >> by date, but while it changed the order of the output (no other >> number did), it wasn=E2=80=99t based on the date column. Not sure = what >> it was based on. >>=20 >> I also tried -k 2,4 and -k 2 -k 3 >>=20 >> I assume I am missing something bloody obvious. >=20 > In the formatting rule of the perl printf command, put a > delimiter, for example "/": "%-50s/%4i-%02i-%02i\n", then > use "| sort -t '/' +1" or "| sort -g -t '/' +1". ISO dates > are sortable by definition. This should sort by the _2nd_ > column with the defined delimiter. Sure, but -k should pick up on white space, I thought. > Or, probably much easier, change the printf command to > create output as " " instead of the example > providing " ", and just send this to "| sort=E2=80=9D. This is what I did, in fact, but I was (and am) confused why sort -k 2 = didn=E2=80=99t work on the original output. --=20 Some people are like a Slinky toy - not really good for anything, but you still can't help but smile when you shove them down the stairs. From owner-freebsd-questions@freebsd.org Sun Jul 14 10:57:37 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id E751815DF3C6 for ; Sun, 14 Jul 2019 10:57:36 +0000 (UTC) (envelope-from andipersti@gmail.com) Received: from mail-wr1-x435.google.com (mail-wr1-x435.google.com [IPv6:2a00:1450:4864:20::435]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id E2A306C706 for ; Sun, 14 Jul 2019 10:57:35 +0000 (UTC) (envelope-from andipersti@gmail.com) Received: by mail-wr1-x435.google.com with SMTP id c2so10925421wrm.8 for ; Sun, 14 Jul 2019 03:57:35 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-language:content-transfer-encoding; bh=/yoZlDXWKl2LLqa70ADp86jNMn+15IPJWRlvxlUbSts=; b=J+rMnxvbzt7PZeS5e4qQsUDRJJ3FHXBZa4cfIjjbcyeBHyL0lWwpi29GMasEr/lnmi McaFR4ITeG6+UE9xXt2p1X/g92K6q3Xq/4ClDTQEmpeFlnrdekdOKZN7xThlTeW2EPld KL9fo/gGAsy8kZu9cGcgMo2QGLRepWtZIAS3t2vpUp9c8DnIyotgVaIKYDUeth0B2OTe /YY8TQACBFenwsq6DDqt0imdUPh/knxqSxaBUqnUYZSFCk8X7XzA4ZTzA+xP/BFgH464 gBIQdcr0mKPyYw2VjSiuyY6q2aNRAJAlEn4ZQrnY8diU3ijB5Fv6fW1xm/2l2slKfSRu 5RNA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-language :content-transfer-encoding; bh=/yoZlDXWKl2LLqa70ADp86jNMn+15IPJWRlvxlUbSts=; b=ckq7bJ9AQGkbtvxiogrKqesOBEiTIOO5PNBaDV4atM3JERnBmE6coj8mgl5LDHZX0E 4y4OEcN9546UsWAXU9gfKKinS6wCe8tK3piaVX1tTMjc1GMGwJLyU8clmB6ZpANOLkMy Xb2C8Vcb+F3d0o4zDuo6IIYEfpzLivi8lLH8AFG7nKyhDcOxeNpnn1fR3vgg4c9TZTKL xj4U1xoNHrcNKGf1dNjKiu2lx37ZabTV6Z+dMbgI+Povi8hKn8vxZEZT8+iImWD0MzNZ rEC2UJbH7AZwK/FcTtCJI9KnIPCFSx9vmRAaerAjKstpPeMmiYzI3cZnsZZ9ooUWvw57 QpZw== X-Gm-Message-State: APjAAAUMna4Obh2+KJGu1cLbAl1DnEMxYRuTIVYG+wwka3WuKLxfmpP0 Z1Ug2QyuXxXud0OVYyR9aQmUdjrc X-Google-Smtp-Source: APXvYqygCLLJfFXUHG+FwBT/O9ojohbiCyq39lv0ao2dy8FVtqZw2l3Rdcus/9gP4YDKlXVUVGQ0aA== X-Received: by 2002:adf:e843:: with SMTP id d3mr14217393wrn.249.1563101854064; Sun, 14 Jul 2019 03:57:34 -0700 (PDT) Received: from [192.168.178.20] (91-119-90-56.dsl.dynamic.surfer.at. [91.119.90.56]) by smtp.googlemail.com with ESMTPSA id c1sm27450655wrh.1.2019.07.14.03.57.33 for (version=TLS1_3 cipher=AEAD-AES128-GCM-SHA256 bits=128/128); Sun, 14 Jul 2019 03:57:33 -0700 (PDT) Subject: Re: pkg query timestamp format To: freebsd-questions@freebsd.org References: <5D28CD7B.40102@webtent.org> <5343D197-AF3A-490E-AB75-F0624A77A3FE@kreme.com> From: Andreas Perstinger Message-ID: Date: Sun, 14 Jul 2019 12:57:32 +0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.7.2 MIME-Version: 1.0 In-Reply-To: <5343D197-AF3A-490E-AB75-F0624A77A3FE@kreme.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US-large Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: E2A306C706 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=J+rMnxvb; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of andipersti@gmail.com designates 2a00:1450:4864:20::435 as permitted sender) smtp.mailfrom=andipersti@gmail.com X-Spamd-Result: default: False [-6.60 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.62)[-0.619,0]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-2.97)[ip: (-9.45), ipnet: 2a00:1450::/32(-2.89), asn: 15169(-2.44), country: US(-0.06)]; RCVD_IN_DNSWL_NONE(0.00)[5.3.4.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 10:57:37 -0000 On 13.07.19 11:31, @lbutlr wrote: >> On 12 Jul 2019, at 18:30, David Christensen wrote: >> Here's a Perl one-liner: >> >> 2019-07-12 17:28:52 dpchrist@cvs ~ >> $ pkg query %n-%t | perl -ne '/(.+)-(\d+)$/; ($d,$m,$y)=(localtime $2)[3,4,5];$y+=1900; printf "%-50s %4i-%02i-%02i\n", $1, $y, $m ,$d' >> bash 2019-01-21 >> cvs 2019-01-21 >> gettext-runtime 2019-01-21 >> > > I tried to add a | sort -k 2, thinking that would sort the output by date, but while it changed the order of the output (no other number did), it wasn’t based on the date column. Not sure what it was based on. > > I also tried -k 2,4 and -k 2 -k 3 > > I assume I am missing something bloody obvious. TL;DR use sort -b -k 2 From man sort: "A field is defined as a maximal sequence of characters other than the field separator and record separator (newline by default). Initial blank spaces are included in the field unless -b has been specified; the first blank space of a sequence of blank spaces acts as the field separator and is included in the field (unless -t is specified). For example, all blank spaces at the beginning of a line are considered to be part of the first field." So you should notice that packages with short names are listed first because there are more blank spaces in front of the dates. Only when package names have the equal number of letters the dates get sorted as you expected. Bye, Andreas From owner-freebsd-questions@freebsd.org Sun Jul 14 12:23:48 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 9242615E13D1 for ; Sun, 14 Jul 2019 12:23:48 +0000 (UTC) (envelope-from karl@denninger.net) Received: from colo1.denninger.net (colo1.denninger.net [104.236.120.189]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 83A936F1C1 for ; Sun, 14 Jul 2019 12:23:47 +0000 (UTC) (envelope-from karl@denninger.net) Received: from denninger.net (ip68-1-57-197.pn.at.cox.net [68.1.57.197]) by colo1.denninger.net (Postfix) with ESMTP id 29651211089 for ; Sun, 14 Jul 2019 08:23:11 -0400 (EDT) Received: from [192.168.10.28] (D18.Denninger.Net [192.168.10.28]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by denninger.net (Postfix) with ESMTPSA id D11A716A5E3 for ; Sun, 14 Jul 2019 07:23:10 -0500 (CDT) Subject: Re: dead slow update servers To: freebsd-questions@freebsd.org References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> From: Karl Denninger Openpgp: preference=signencrypt Autocrypt: addr=karl@denninger.net; prefer-encrypt=mutual; keydata= mQINBFIX1zsBEADRcJfsQUl9oFeoMfLPJ1kql+3sIaYx0MfJAUhV9LnbWxr0fsWCskM1O4cV tHm5dqPkuPM4Ztc0jLotD1i9ubWvCHOlkLGxFOL+pFbjA+XZ7VKsC/xWmhMwJ3cM8HavK2OV SzEWQ/AEYtMi04IzGSwsxh/5/5R0mPHrsIomV5SbuiI0vjLuDj7fo6146AABI1ULzge4hBYW i/SHrqUrLORmUNBs6bxek79/B0Dzk5cIktD3LOfbT9EAa5J/osVkstMBhToJgQttaMIGv8SG CzpR/HwEokE+7DP+k2mLHnLj6H3kfugOF9pJH8Za4yFmw//s9cPXV8WwtZ2SKfVzn1unpKqf wmJ1PwJoom/d4fGvQDkgkGKRa6RGC6tPmXnqnx+YX4iCOdFfbP8L9rmk2sewDDVzHDU3I3ZZ 8hFIjMYM/QXXYszRatK0LCV0QPZuF7LCf4uQVKw1/oyJInsnH7+6a3c0h21x+CmSja9QJ+y0 yzgEN/nM89d6YTakfR+1xkYgodVmMy/bS8kmXbUUZG/CyeqCqc95RUySjKT2ECrf9GhhoQkl +D8n2MsrAUSMGB4GQSN+TIq9OBTpNuvATGSRuF9wnQcs1iSry+JNCpfRTyWp83uCNApe6oHU EET4Et6KDO3AvjvBMAX0TInTRGW2SQlJMuFKpc7Dg7tHK8zzqQARAQABtCNLYXJsIERlbm5p bmdlciA8a2FybEBkZW5uaW5nZXIubmV0PokCPAQTAQIAJgUCUhfXOwIbIwUJCWYBgAYLCQgH AwIEFQIIAwQWAgMBAh4BAheAAAoJEG6/sivc5s0PLxQP/i6x/QFx9G4Cw7C+LthhLXIm7NSH AtNbz2UjySEx2qkoQQjtsK6mcpEEaky4ky6t8gz0/SifIfJmSmyAx0UhUQ0WBv1vAXwtNrQQ jJd9Bj6l4c2083WaXyHPjt2u2Na6YFowyb4SaQb83hu/Zs25vkPQYJVVE0JX409MFVPUa6E3 zFbd1OTr3T4yNUy4gNeQZfzDqDS8slbIks2sXeoJrZ6qqXVI0ionoivOlaN4T6Q0UYyXtigj dQvvhMt0aNowKFjRqrmSDRpdz+o6yg7Mp7qEZ1V6EZk8KqQTH6htpCTQ8i79ttK4LG6bstSF Re6Fwq52nbrcANrcdmtZXqjo+SGbUqJ8b1ggrxAsJ5MEhRh2peKrCgI/TjQo+ZxfnqEoR4AI 46Cyiz+/lcVvlvmf2iPifS3EEdaH3Itfwt7MxFm6mQORYs6skHDw3tOYB2/AdCW6eRVYs2hB RMAG4uwApZfZDKgRoE95PJmQjeTBiGmRPcsQZtNESe7I7EjHtCDLwtJqvD4HkDDQwpzreT6W XkyIJ7ns7zDfA1E+AQhFR6rsTFGgQZRZKsVeov3SbhYKkCnVDCvb/PKQCAGkSZM9SvYG5Yax 8CMry3AefKktf9fqBFg8pWqtVxDwJr56dhi0GHXRu3jVI995rMGo1fLUG5fSxiZ8L5sAtokh 9WFmQpyl Message-ID: Date: Sun, 14 Jul 2019 07:23:10 -0500 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 In-Reply-To: <87v9w58apd.fsf@toy.adminart.net> Content-Type: multipart/signed; protocol="application/pkcs7-signature"; micalg=sha-512; boundary="------------ms030502070409030609000708" X-Rspamd-Queue-Id: 83A936F1C1 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-6.81 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_ATTACHMENT(0.00)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; MX_GOOD(-0.01)[px.denninger.net]; NEURAL_HAM_SHORT(-0.97)[-0.966,0]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:14061, ipnet:104.236.64.0/18, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:+]; MID_RHS_MATCH_FROM(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[197.57.1.68.zen.spamhaus.org : 127.0.0.11]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; SIGNED_SMIME(-2.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.20)[multipart/signed,multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-2.63)[ip: (-9.86), ipnet: 104.236.64.0/18(-4.31), asn: 14061(1.07), country: US(-0.06)]; DMARC_NA(0.00)[denninger.net]; R_SPF_NA(0.00)[] X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 12:23:48 -0000 This is a cryptographically signed message in MIME format. --------------ms030502070409030609000708 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On 7/14/2019 00:10, hw wrote: > "Kevin P. Neal" writes: > >> On Sat, Jul 13, 2019 at 05:39:51AM +0200, hw wrote: >>> ZFS is great when you have JBODs while storage performance is >>> irrelevant. I do not have JBODs, and in almost all cases, storage >>> performance is relevant. >> Huh? Is a _properly_ _designed_ ZFS setup really slower? A raidz >> setup of N drives gets you the performance of roughly 1 drive, but a >> mirror gets you the write performance of a titch less than one drive >> with the read performance of N drives. How does ZFS hurt performance? > Performance is hurt when you have N disks and only get the performance > of a single disk from them. There's no free lunch.=C2=A0 If you want two copies of the data (or one p= lus parity) you must write two copies.=C2=A0 The second one doesn't magically= appear.=C2=A0 If you think it did you were conned by something that is cheating (e.g. said it had written something when in fact it was sitting in a DRAM chip) and, at a bad time, you're going to discover it was cheating. Murphy is a SOB. > Mirroring the N disks would require another N disks, which you don't > have. > > "Performance" isn't much better defined as "properly designed" here. I= n > practise, I prefer a hardware RAID5 with N disks over a raidz with N > disks and a RAID10 over a RAID5. Unfortunately, in practise, the numbe= r > of disks is limited because they aren't cheap and because only so many > disks can be connected to a machine without further ado while there is = a > certain requirement for storage capacity. Reality is not proper > designed :/ > > > What do you do when you put FreeBSD on a server that has a hardware RAI= D > controller which doesn't do JBOD? Use ZFS on the RAID? Throw said controller in the trash and get a proper one. Raid controllers were very useful a decade ago when ZFS was trouble-ridden and the controller's firmware was less-so.=C2=A0 Now it's = the other way around. And whether you do your Raid in hardware or software Raidz is Raidz. I binned the last of the hardware RAID adapters in my production machines roughly five years ago.=C2=A0 ZFS got to be faster and more-reli= able than they were. --=20 Karl Denninger karl@denninger.net /The Market Ticker/ /[S/MIME encrypted email preferred]/ --------------ms030502070409030609000708 Content-Type: application/pkcs7-signature; name="smime.p7s" Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename="smime.p7s" Content-Description: S/MIME Cryptographic Signature MIAGCSqGSIb3DQEHAqCAMIACAQExDzANBglghkgBZQMEAgMFADCABgkqhkiG9w0BBwEAAKCC DdgwggagMIIEiKADAgECAhMA5EiKghDOXrvfxYxjITXYDdhIMA0GCSqGSIb3DQEBCwUAMIGL MQswCQYDVQQGEwJVUzEQMA4GA1UECAwHRmxvcmlkYTESMBAGA1UEBwwJTmljZXZpbGxlMRkw FwYDVQQKDBBDdWRhIFN5c3RlbXMgTExDMRgwFgYDVQQLDA9DdWRhIFN5c3RlbXMgQ0ExITAf BgNVBAMMGEN1ZGEgU3lzdGVtcyBMTEMgMjAxNyBDQTAeFw0xNzA4MTcxNjQyMTdaFw0yNzA4 MTUxNjQyMTdaMHsxCzAJBgNVBAYTAlVTMRAwDgYDVQQIDAdGbG9yaWRhMRkwFwYDVQQKDBBD dWRhIFN5c3RlbXMgTExDMRgwFgYDVQQLDA9DdWRhIFN5c3RlbXMgQ0ExJTAjBgNVBAMMHEN1 ZGEgU3lzdGVtcyBMTEMgMjAxNyBJbnQgQ0EwggIiMA0GCSqGSIb3DQEBAQUAA4ICDwAwggIK AoICAQC1aJotNUI+W4jP7xQDO8L/b4XiF4Rss9O0B+3vMH7Njk85fZ052QhZpMVlpaaO+sCI KqG3oNEbuOHzJB/NDJFnqh7ijBwhdWutdsq23Ux6TvxgakyMPpT6TRNEJzcBVQA0kpby1DVD 0EKSK/FrWWBiFmSxg7qUfmIq/mMzgE6epHktyRM3OGq3dbRdOUgfumWrqHXOrdJz06xE9NzY vc9toqZnd79FUtE/nSZVm1VS3Grq7RKV65onvX3QOW4W1ldEHwggaZxgWGNiR/D4eosAGFxn uYeWlKEC70c99Mp1giWux+7ur6hc2E+AaTGh+fGeijO5q40OGd+dNMgK8Es0nDRw81lRcl24 SWUEky9y8DArgIFlRd6d3ZYwgc1DMTWkTavx3ZpASp5TWih6yI8ACwboTvlUYeooMsPtNa9E 6UQ1nt7VEi5syjxnDltbEFoLYcXBcqhRhFETJe9CdenItAHAtOya3w5+fmC2j/xJz29og1KH YqWHlo3Kswi9G77an+zh6nWkMuHs+03DU8DaOEWzZEav3lVD4u76bKRDTbhh0bMAk4eXriGL h4MUoX3Imfcr6JoyheVrAdHDL/BixbMH1UUspeRuqQMQ5b2T6pabXP0oOB4FqldWiDgJBGRd zWLgCYG8wPGJGYgHibl5rFiI5Ix3FQncipc6SdUzOQIDAQABo4IBCjCCAQYwHQYDVR0OBBYE FF3AXsKnjdPND5+bxVECGKtc047PMIHABgNVHSMEgbgwgbWAFBu1oRhUMNEzjODolDka5k4Q EDBioYGRpIGOMIGLMQswCQYDVQQGEwJVUzEQMA4GA1UECAwHRmxvcmlkYTESMBAGA1UEBwwJ TmljZXZpbGxlMRkwFwYDVQQKDBBDdWRhIFN5c3RlbXMgTExDMRgwFgYDVQQLDA9DdWRhIFN5 c3RlbXMgQ0ExITAfBgNVBAMMGEN1ZGEgU3lzdGVtcyBMTEMgMjAxNyBDQYIJAKxAy1WBo2kY MBIGA1UdEwEB/wQIMAYBAf8CAQAwDgYDVR0PAQH/BAQDAgGGMA0GCSqGSIb3DQEBCwUAA4IC AQCB5686UCBVIT52jO3sz9pKuhxuC2npi8ZvoBwt/IH9piPA15/CGF1XeXUdu2qmhOjHkVLN gO7XB1G8CuluxofOIUce0aZGyB+vZ1ylHXlMeB0R82f5dz3/T7RQso55Y2Vog2Zb7PYTC5B9 oNy3ylsnNLzanYlcW3AAfzZcbxYuAdnuq0Im3EpGm8DoItUcf1pDezugKm/yKtNtY6sDyENj tExZ377cYA3IdIwqn1Mh4OAT/Rmh8au2rZAo0+bMYBy9C11Ex0hQ8zWcvPZBDn4v4RtO8g+K uQZQcJnO09LJNtw94W3d2mj4a7XrsKMnZKvm6W9BJIQ4Nmht4wXAtPQ1xA+QpxPTmsGAU0Cv HmqVC7XC3qxFhaOrD2dsvOAK6Sn3MEpH/YrfYCX7a7cz5zW3DsJQ6o3pYfnnQz+hnwLlz4MK 17NIA0WOdAF9IbtQqarf44+PEyUbKtz1r0KGeGLs+VGdd2FLA0e7yuzxJDYcaBTVwqaHhU2/ Fna/jGU7BhrKHtJbb/XlLeFJ24yvuiYKpYWQSSyZu1R/gvZjHeGb344jGBsZdCDrdxtQQcVA 6OxsMAPSUPMrlg9LWELEEYnVulQJerWxpUecGH92O06wwmPgykkz//UmmgjVSh7ErNvL0lUY UMfunYVO/O5hwhW+P4gviCXzBFeTtDZH259O7TCCBzAwggUYoAMCAQICEwCg0WvVwekjGFiO 62SckFwepz0wDQYJKoZIhvcNAQELBQAwezELMAkGA1UEBhMCVVMxEDAOBgNVBAgMB0Zsb3Jp ZGExGTAXBgNVBAoMEEN1ZGEgU3lzdGVtcyBMTEMxGDAWBgNVBAsMD0N1ZGEgU3lzdGVtcyBD QTElMCMGA1UEAwwcQ3VkYSBTeXN0ZW1zIExMQyAyMDE3IEludCBDQTAeFw0xNzA4MTcyMTIx MjBaFw0yMjA4MTYyMTIxMjBaMFcxCzAJBgNVBAYTAlVTMRAwDgYDVQQIDAdGbG9yaWRhMRkw FwYDVQQKDBBDdWRhIFN5c3RlbXMgTExDMRswGQYDVQQDDBJrYXJsQGRlbm5pbmdlci5uZXQw ggIiMA0GCSqGSIb3DQEBAQUAA4ICDwAwggIKAoICAQC+HVSyxVtJhy3Ohs+PAGRuO//Dha9A 16l5FPATr6wude9zjX5f2lrkRyU8vhCXTZW7WbvWZKpcZ8r0dtZmiK9uF58Ec6hhvfkxJzbg 96WHBw5Fumd5ahZzuCJDtCAWW8R7/KN+zwzQf1+B3MVLmbaXAFBuKzySKhKMcHbK3/wjUYTg y+3UK6v2SBrowvkUBC+jxNg3Wy12GsTXcUS/8FYIXgVVPgfZZrbJJb5HWOQpvvhILpPCD3xs YJFNKEPltXKWHT7Qtc2HNqikgNwj8oqOb+PeZGMiWapsatKm8mxuOOGOEBhAoTVTwUHlMNTg 6QUCJtuWFCK38qOCyk9Haj+86lUU8RG6FkRXWgMbNQm1mWREQhw3axgGLSntjjnznJr5vsvX SYR6c+XKLd5KQZcS6LL8FHYNjqVKHBYM+hDnrTZMqa20JLAF1YagutDiMRURU23iWS7bA9tM cXcqkclTSDtFtxahRifXRI7Epq2GSKuEXe/1Tfb5CE8QsbCpGsfSwv2tZ/SpqVG08MdRiXxN 5tmZiQWo15IyWoeKOXl/hKxA9KPuDHngXX022b1ly+5ZOZbxBAZZMod4y4b4FiRUhRI97r9l CxsP/EPHuuTIZ82BYhrhbtab8HuRo2ofne2TfAWY2BlA7ExM8XShMd9bRPZrNTokPQPUCWCg CdIATQIDAQABo4IBzzCCAcswPAYIKwYBBQUHAQEEMDAuMCwGCCsGAQUFBzABhiBodHRwOi8v b2NzcC5jdWRhc3lzdGVtcy5uZXQ6ODg4ODAJBgNVHRMEAjAAMBEGCWCGSAGG+EIBAQQEAwIF oDAOBgNVHQ8BAf8EBAMCBeAwHQYDVR0lBBYwFAYIKwYBBQUHAwIGCCsGAQUFBwMEMDMGCWCG SAGG+EIBDQQmFiRPcGVuU1NMIEdlbmVyYXRlZCBDbGllbnQgQ2VydGlmaWNhdGUwHQYDVR0O BBYEFLElmNWeVgsBPe7O8NiBzjvjYnpRMIHKBgNVHSMEgcIwgb+AFF3AXsKnjdPND5+bxVEC GKtc047PoYGRpIGOMIGLMQswCQYDVQQGEwJVUzEQMA4GA1UECAwHRmxvcmlkYTESMBAGA1UE BwwJTmljZXZpbGxlMRkwFwYDVQQKDBBDdWRhIFN5c3RlbXMgTExDMRgwFgYDVQQLDA9DdWRh IFN5c3RlbXMgQ0ExITAfBgNVBAMMGEN1ZGEgU3lzdGVtcyBMTEMgMjAxNyBDQYITAORIioIQ zl6738WMYyE12A3YSDAdBgNVHREEFjAUgRJrYXJsQGRlbm5pbmdlci5uZXQwDQYJKoZIhvcN AQELBQADggIBAJXboPFBMLMtaiUt4KEtJCXlHO/3ZzIUIw/eobWFMdhe7M4+0u3te0sr77QR dcPKR0UeHffvpth2Mb3h28WfN0FmJmLwJk+pOx4u6uO3O0E1jNXoKh8fVcL4KU79oEQyYkbu 2HwbXBU9HbldPOOZDnPLi0whi/sbFHdyd4/w/NmnPgzAsQNZ2BYT9uBNr+jZw4SsluQzXG1X lFL/qCBoi1N2mqKPIepfGYF6drbr1RnXEJJsuD+NILLooTNf7PMgHPZ4VSWQXLNeFfygoOOK FiO0qfxPKpDMA+FHa8yNjAJZAgdJX5Mm1kbqipvb+r/H1UAmrzGMbhmf1gConsT5f8KU4n3Q IM2sOpTQe7BoVKlQM/fpQi6aBzu67M1iF1WtODpa5QUPvj1etaK+R3eYBzi4DIbCIWst8MdA 1+fEeKJFvMEZQONpkCwrJ+tJEuGQmjoQZgK1HeloepF0WDcviiho5FlgtAij+iBPtwMuuLiL shAXA5afMX1hYM4l11JXntle12EQFP1r6wOUkpOdxceCcMVDEJBBCHW2ZmdEaXgAm1VU+fnQ qS/wNw/S0X3RJT1qjr5uVlp2Y0auG/eG0jy6TT0KzTJeR9tLSDXprYkN2l/Qf7/nT6Q03qyE QnnKiBXWAZXveafyU/zYa7t3PTWFQGgWoC4w6XqgPo4KV44OMYIFBzCCBQMCAQEwgZIwezEL MAkGA1UEBhMCVVMxEDAOBgNVBAgMB0Zsb3JpZGExGTAXBgNVBAoMEEN1ZGEgU3lzdGVtcyBM TEMxGDAWBgNVBAsMD0N1ZGEgU3lzdGVtcyBDQTElMCMGA1UEAwwcQ3VkYSBTeXN0ZW1zIExM QyAyMDE3IEludCBDQQITAKDRa9XB6SMYWI7rZJyQXB6nPTANBglghkgBZQMEAgMFAKCCAkUw GAYJKoZIhvcNAQkDMQsGCSqGSIb3DQEHATAcBgkqhkiG9w0BCQUxDxcNMTkwNzE0MTIyMzEx WjBPBgkqhkiG9w0BCQQxQgRAcpPCjLj7U65CoRVecVtT93SNdXAsxJwJ0t3F637KamZeakRF 9nKntfPm+jzm4WXOVkhicRgmt1xZ6IQ6YuCtFTBsBgkqhkiG9w0BCQ8xXzBdMAsGCWCGSAFl AwQBKjALBglghkgBZQMEAQIwCgYIKoZIhvcNAwcwDgYIKoZIhvcNAwICAgCAMA0GCCqGSIb3 DQMCAgFAMAcGBSsOAwIHMA0GCCqGSIb3DQMCAgEoMIGjBgkrBgEEAYI3EAQxgZUwgZIwezEL MAkGA1UEBhMCVVMxEDAOBgNVBAgMB0Zsb3JpZGExGTAXBgNVBAoMEEN1ZGEgU3lzdGVtcyBM TEMxGDAWBgNVBAsMD0N1ZGEgU3lzdGVtcyBDQTElMCMGA1UEAwwcQ3VkYSBTeXN0ZW1zIExM QyAyMDE3IEludCBDQQITAKDRa9XB6SMYWI7rZJyQXB6nPTCBpQYLKoZIhvcNAQkQAgsxgZWg gZIwezELMAkGA1UEBhMCVVMxEDAOBgNVBAgMB0Zsb3JpZGExGTAXBgNVBAoMEEN1ZGEgU3lz dGVtcyBMTEMxGDAWBgNVBAsMD0N1ZGEgU3lzdGVtcyBDQTElMCMGA1UEAwwcQ3VkYSBTeXN0 ZW1zIExMQyAyMDE3IEludCBDQQITAKDRa9XB6SMYWI7rZJyQXB6nPTANBgkqhkiG9w0BAQEF AASCAgALBkkCvR+PSX8+x+fv45ZEN39kEI6L9BOaaaMcIWarwHvir0pUW6ICHhYe1IKHeetz OsJUievIETbxRuACp7avV6+1kE6M1VRMV4YubEJgC7dZ17FKJxoSsk2Y+dVYVqOcZX2JjIn+ HgwsRrrUjTA3pHKWuA7ouu+dSmy3N/v4napFUTmlXqJCz3AKW6Pgjl6xvlR2M9t+0s+xgxOU z4NBJwKsBivrk8n6c/++dIYLpG6mWKTyf/pFIbRY2eG9Tgah18JNdtMI4IaC5SDksT/OgzpE aRsjYb20oNRI+u0njbXfxZ1qMv/bGXq1l7HLh06VH44zt/diGvWehLTh2Ll+BHN5HhCnkSMU lwBoUtJ5D5yQ1Mt4ymUcQ6Qe3xz+mj50Dc+P/B9I1C28BvhS/Zf24Lp8wAUER5zZrmIpvIHZ hrJIg2bkWyFgJbo7PyoOuHoqAKKjSvd2cWUZ5ZSMeBcNbrNGac7JgJhxxdbPrgEcpCgsX5vv WgM1bVfURGceSR/jXguI/LViMeiQfZL8qMdA5BPJIN8rWwIDGykgRsRkS4HblJg6qZKWgP6H YCIdnFDsUiZrvB3PegdoMBhTckP5ECJoRVkLM9Q4sCzk778LsU/RFvAYMSE9ma5+NilSZoZm Ne/SN0gomlgVs7X9iev168aoSXIZ70kNbE9ZkUh5uwAAAAAAAA== --------------ms030502070409030609000708-- From owner-freebsd-questions@freebsd.org Sun Jul 14 13:00:28 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 04A9415E1F38 for ; Sun, 14 Jul 2019 13:00:28 +0000 (UTC) (envelope-from Lena@lena.kiev.ua) Received: from lena.kiev.ua (lena.kiev.ua [62.109.6.225]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 0D72B700C0 for ; Sun, 14 Jul 2019 13:00:24 +0000 (UTC) (envelope-from Lena@lena.kiev.ua) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lena.kiev.ua; s=3; h=In-Reply-To:Content-Type:Mime-Version:References: Message-ID:Subject:To:From:Date:Sender:Reply-To:Cc:Content-Transfer-Encoding: Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender: Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=oiRCXI58v8ECTwjWo0OpcwnzN/e+Ih7ELC3m7W8U0LQ=; b=JqA/ooYIwyI/QEHJCb9z5cbu7a mrfqFH5ypw7JP5Utnj4bQJ7KTRuuczlSyDBjAlhBop7IzFA0bRxKtwgKzX3BFKQnLf7ho8d5grE+f lCTqH8rZOSzRKRnNhEOqnV9vAy1GtZklo7tBdljpfqsX5lMWdoZfqeJKXbjDHLXXGlH4=; Received: from ip-1926.rusanovka-net.kiev.ua ([94.244.25.38] helo=bedside.lena.kiev.ua) by lena.kiev.ua with esmtpsa (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92 (FreeBSD)) (envelope-from ) id 1hme77-0008zO-4o for freebsd-questions@freebsd.org; Sun, 14 Jul 2019 16:00:25 +0300 Received: from bedside.lena.kiev.ua (localhost.lena.kiev.ua [127.0.0.1]) by bedside.lena.kiev.ua (8.15.2/8.15.2) with ESMTP id x6ED0Erb027698 for ; Sun, 14 Jul 2019 16:00:14 +0300 (EEST) (envelope-from Lena@lena.kiev.ua) Received: (from lena@localhost) by bedside.lena.kiev.ua (8.15.2/8.15.2/Submit) id x6ED0Ejr027697 for freebsd-questions@freebsd.org; Sun, 14 Jul 2019 16:00:14 +0300 (EEST) (envelope-from Lena@lena.kiev.ua) Date: Sun, 14 Jul 2019 16:00:14 +0300 From: Lena@lena.kiev.ua To: freebsd-questions@freebsd.org Subject: Re: How to explore Android device files under FreeBSD ? Message-ID: <20190714130014.GG787@lena.kiev> References: Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: User-Agent: Mutt/1.4.2.3i X-Rspamd-Queue-Id: 0D72B700C0 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=lena.kiev.ua header.s=3 header.b=JqA/ooYI; dmarc=pass (policy=none) header.from=lena.kiev.ua; spf=pass (mx1.freebsd.org: domain of Lena@lena.kiev.ua designates 62.109.6.225 as permitted sender) smtp.mailfrom=Lena@lena.kiev.ua X-Spamd-Result: default: False [0.73 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[mail.lena.kiev.ua]; DKIM_TRACE(0.00)[lena.kiev.ua:+]; DMARC_POLICY_ALLOW(-0.50)[lena.kiev.ua,none]; RCVD_IN_DNSWL_MED(-0.20)[225.6.109.62.list.dnswl.org : 127.0.6.2]; FROM_EQ_ENVFROM(0.00)[]; IP_SCORE(0.51)[asn: 29182(2.53), country: RU(0.01)]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:29182, ipnet:62.109.0.0/21, country:RU]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[lena.kiev.ua:s=3]; RCVD_TLS_LAST(0.00)[]; DWL_DNSWL_MED(0.00)[lena.kiev.ua.dwl.dnswl.org : 127.0.6.2]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.66)[-0.662,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; NEURAL_SPAM_MEDIUM(0.22)[0.217,0]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_SPAM_SHORT(0.87)[0.872,0]; FROM_NO_DN(0.00)[]; RBL_COMPOSITE_RCVD_IN_DNSWL_MED_DWL_DNSWL_MED(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 13:00:28 -0000 > Somebody has asked me for some images on my Android phone. > So I first need to download those files from the phone to my FreeBSD box pkg install android-file-transfer In /etc/devfs.rules allow your usual user access to USB: [localrules=10] add path 'ugen*' mode 0660 group yourgroup add path 'usb?*' mode 0660 group yourgroup add path 'usb/*' mode 0660 group yourgroup As that user: aft-mtp-cli "cd DCIM" "get Camera" That creates directory 'Camera' and downloads photos into it. From owner-freebsd-questions@freebsd.org Sun Jul 14 13:43:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.ysv.freebsd.org (Postfix) with ESMTP id 559CF15E2E2F for ; Sun, 14 Jul 2019 13:43:08 +0000 (UTC) (envelope-from kamisouckova@gmail.com) Received: from mail-vs1-f68.google.com (mail-vs1-f68.google.com [209.85.217.68]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 7CA2D716FA for ; Sun, 14 Jul 2019 13:43:07 +0000 (UTC) (envelope-from kamisouckova@gmail.com) Received: by mail-vs1-f68.google.com with SMTP id r3so9646951vsr.13 for ; Sun, 14 Jul 2019 06:43:07 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=KrC84wexXPL8cLGnoHIbVpk31CQULqLtNpbNJe1uXdw=; b=CRTGQbeJFeKQuFKtggYrq/gZnz8xT8Vhx9IXAQde+kbt3EaAw0w67GCB1J366LmXMU Gpiq61+B3zvslMWYAHJXb2ixzEPNLlhQZBHWaMZSwcTnrZI9mrV4KmWXw3fiBFW25Gg8 DWiYR2oJsLz+kWCvWsScG3YG5reaU9ZVxjUjrrrQtIBS7gK4+gIllCyVgwvS902Ea/xI FfPaAE4QRrrWpeMTnI8QbC6USt+bk+fs/8Rh4b3uUSePXCll9RfibCtjY06sOOedS4ro djAB5JwrsAyRVwcxPEAmARt/JI6kDh12HgOKjqgZnTDDZ0d6y9Pa5Zne5e6PzACiPPy2 HUbg== X-Gm-Message-State: APjAAAXweuytQNbtVVnPZ9eLkxWnm6cgIIzHvokBk3P9eIy3m5/+u7nO kRBNhjesw/3p2ggHYCWDPT2KtTb8B528w5XPZAk= X-Google-Smtp-Source: APXvYqwDC9vldZdfNI3N+vpMRgQqGJKVvxanBChw187eQevUTQBhk2moMGMFglq+wsmYTmi0dsN169kp/twosR2FLbI= X-Received: by 2002:a67:f5c5:: with SMTP id t5mr13699530vso.27.1563110168985; Sun, 14 Jul 2019 06:16:08 -0700 (PDT) MIME-Version: 1.0 References: <6b6670c9-277b-e874-f82b-dcaa38fa82a4@jensenwaud.com> In-Reply-To: <6b6670c9-277b-e874-f82b-dcaa38fa82a4@jensenwaud.com> From: =?UTF-8?B?S2FtaWxhIFNvdcSNa292w6E=?= Date: Sun, 14 Jul 2019 15:15:52 +0200 Message-ID: Subject: Re: How to explore Android device files under FreeBSD ? To: Anders Jensen-Waud Cc: Manish Jain , "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: 7CA2D716FA X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of kamisouckova@gmail.com designates 209.85.217.68 as permitted sender) smtp.mailfrom=kamisouckova@gmail.com X-Spamd-Result: default: False [-2.53 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:209.85.128.0/17]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; NEURAL_HAM_SHORT(-0.34)[-0.338,0]; FORGED_SENDER(0.30)[kamila@ksp.sk,kamisouckova@gmail.com]; IP_SCORE(-1.19)[ipnet: 209.85.128.0/17(-3.46), asn: 15169(-2.44), country: US(-0.06)]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[gmail.com]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[kamila@ksp.sk,kamisouckova@gmail.com]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.994,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[ksp.sk]; MIME_TRACE(0.00)[0:+,1:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[68.217.85.209.list.dnswl.org : 127.0.5.0]; RCVD_TLS_LAST(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[68.217.85.209.rep.mailspike.net : 127.0.0.17]; RCVD_COUNT_TWO(0.00)[2]; FREEMAIL_CC(0.00)[hotmail.com] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 13:43:08 -0000 > I have used FUSE to download photos from my Android phone connected via > a micro-USB to USB cable. Once connected to my FreeBSD box, I enabled > MTP and I could use FUSE to access it similar to a digital camera. > > From memory it was using the package 'fusefs-simple-mtpfs-0.3.0_4'. This also worked for me, no issues. I ran sudo simple-mtpfs /mnt/phone Remember to kldload fuse before. The phone must be in MTP mode for this. Best, Kamila From owner-freebsd-questions@freebsd.org Sun Jul 14 18:09:14 2019 Return-Path: Delivered-To: freebsd-questions@mailman.ysv.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1C3C7A1AFE for ; Sun, 14 Jul 2019 18:09:14 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.17.24]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 7684A83589 for ; Sun, 14 Jul 2019 17:44:26 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.223.163.113]) by mrelayeu.kundenserver.de (mreue108 [212.227.15.183]) with ESMTPA (Nemesis) id 1N33AR-1iTMrp03zR-013LvU for ; Sun, 14 Jul 2019 19:44:20 +0200 Date: Sun, 14 Jul 2019 19:44:16 +0200 From: Polytropon To: "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Message-Id: <20190714194416.6948d301.freebsd@edvax.de> In-Reply-To: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:xjhw0XOVxNg/JRqNQw8u6+Pv1ZCVNjYqmRHkpED8MSzl6RqDkit RwJvNvOhpWYmMjL2tqZO0IPKFPVd0jg+2nbCnXL3dYnGFOQZC2fWElRyoIDsf7dRZciVAor 9pmyTH7Z2Ah7UJuFTS3FOnzTUzfrbDwk6RfYyhCGCQd3IMbOlaqVb9MkUDmZNulVx3ktB98 ZOmLcF7uIp6LWSmZlHQMA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:2DvuIKzN1A0=:IAX9bs9D5W/OtVdH9ZEBzJ tBESWAEqkdEavKg96Ga9v2bANrRuMGtg+bsnipaw29w9qR0FNfbfavOssOwDGLeH1cxOZjQyz vmLFBJwM0xjowkXeM9x0ZZo08Agi0f20QubNfPBCFmWPuX12kjAslaRSrvKZRzbFnXqkUckan h/vmnxVs0o98UKKU9XH6O1TlKQj4f3JV12f9bVVp4AmLwigo3hkc+IFwunb0n0YemOi4/0whY /pnxT2w08i9MmizpSKHUy+Ui7+aUEsSM8K81nBZ5BHKBgNJ3IlMWVI7sJlt8SVDGFfoE3SRrI ddaO5/UYFqnF/T6JT6U2Zc1ICiTvFADGOVTUZIxLfTohBV49di4EkKiBJITJzLSwESunOEb+/ pwUsaZY2BMr5J4CrrvurY1Vv/DjeQYt5RNXSMNvCoWgML38RL0XoNCflfP/Lm4cWCAmTZi5P/ y5cTZBA1IrfsYZ6N+AOLyqgMq+fFyobdWyaDgRBrZ+nWcfHg/l+4ih4atvVzGAgP8kj5AEL1K hVDY3cTvJ5RixQZL5dAoow+kK1XN6W0wOFmVv9PydRhSdqfGDfux/NH+jg/JxO+RpTbnEBr8H o55fe6UbZgl5g57yGT0iBmO7woIL6gMjW1xs88lqm4/ZOM5/i1exR28KHTaZqyzV116tpeW/f b41BvRWYTuiyumQ7hF9R3NViBZx3rwbc4WISZ/MJMWbKrWezlcb1brzxpsUGxDY3oEo6VGSxz eYgpO4NauxGUvqLb3A3FvXFPU6r7Of6H07GvHDXiJPEIjgLKs+68ftf1lWA= X-Rspamd-Queue-Id: 7684A83589 X-Spamd-Bar: +++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [5.03 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[cached: mx00.schlund.de]; RECEIVED_SPAMHAUS_PBL(0.00)[113.163.223.94.zen.spamhaus.org : 127.0.0.11]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_SPAM_SHORT(0.22)[0.222,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_SPAM_MEDIUM(0.33)[0.330,0]; MIME_TRACE(0.00)[0:+]; NEURAL_SPAM_LONG(1.00)[0.999,0]; RCVD_IN_DNSWL_NONE(0.00)[24.17.227.212.list.dnswl.org : 127.0.5.0]; MID_CONTAINS_FROM(1.00)[]; TO_DN_EQ_ADDR_ALL(0.00)[]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; IP_SCORE(0.09)[ip: (-0.49), ipnet: 212.227.0.0/16(-1.43), asn: 8560(2.40), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 18:09:14 -0000 On Sun, 14 Jul 2019 01:34:46 +0200, Kjell Tore Ullavik wrote: > One simple way is to just install and start a ftp-server app on your phone. On Sat, 13 Jul 2019 19:36:08 -0400, Vlad D. Markov wrote: > I gave up on connecting via cabling. I installed an app that made > my phone an ftp server then I ftped the files onto my computer. Why doesn't it seem to occur to people that this sounds entirely wrong? It's not that it is impossible, or doesn't work - but shouldn't it be much easier to copy _your_ photos from _your_ phone without requiring a 3rd party app, registering for a crappy cloud service, or mess with "developer settings"? In my opinion, it should be as easy as attaching the USB cable and then immediately having access to a direct access mass storage, as per the standard. Mount it, copy your files, unmount it, done. No need for apps and cloud nonsense. Of course, using an MTP interface is also easy, and with GUI tools like gtkam, access is super easy. It should work that way by default, with cable. Why do manufacturers think it's okay to make things needlessly complicated? I mean... I even got this working with an iPad, so why should an Android-based phone, where Android is usually considered "some kind of Linux", force you to do annoying things? I think with the tools available on FreeBSD, it should be possible to get images copied from an Android phone without much messing with that phone. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Sun Jul 14 18:22:51 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 588A9A2D8D for ; Sun, 14 Jul 2019 18:22:51 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from ms-10.1blu.de (ms-10.1blu.de [178.254.4.101]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 0DB7B86B44 for ; Sun, 14 Jul 2019 18:22:49 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from [80.187.83.47] (helo=localhost.unixarea.de) by ms-10.1blu.de with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.86_2) (envelope-from ) id 1hmj94-0004Dm-Nw; Sun, 14 Jul 2019 20:22:46 +0200 Received: from localhost.my.domain (localhost [127.0.0.1]) by localhost.unixarea.de (8.15.2/8.14.9) with ESMTPS id x6EIMjQw002470 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 14 Jul 2019 20:22:45 +0200 (CEST) (envelope-from guru@unixarea.de) Received: (from guru@localhost) by localhost.my.domain (8.15.2/8.14.9/Submit) id x6EIMjw2002469; Sun, 14 Jul 2019 20:22:45 +0200 (CEST) (envelope-from guru@unixarea.de) X-Authentication-Warning: localhost.my.domain: guru set sender to guru@unixarea.de using -f Date: Sun, 14 Jul 2019 20:22:45 +0200 From: Matthias Apitz To: Polytropon Cc: "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Message-ID: <20190714182245.GA2405@c720-r342378> Reply-To: Matthias Apitz Mail-Followup-To: Polytropon , "freebsd-questions@freebsd.org" References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <20190714194416.6948d301.freebsd@edvax.de> X-Operating-System: FreeBSD 13.0-CURRENT r342378 (amd64) X-message-flag: Mails containing HTML will not be read! Please send only plain text. User-Agent: Mutt/1.11.1 (2018-12-01) X-Con-Id: 51246 X-Con-U: 0-guru X-Originating-IP: 80.187.83.47 X-Rspamd-Queue-Id: 0DB7B86B44 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-3.63 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XOIP(0.00)[]; TO_DN_SOME(0.00)[]; HAS_REPLYTO(0.00)[guru@unixarea.de]; IP_SCORE(-2.96)[ip: (-8.68), ipnet: 178.254.0.0/19(-3.50), asn: 42730(-2.63), country: DE(-0.01)]; HAS_XAW(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[cached: mail.unixarea.de]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.96)[-0.955,0]; RCVD_IN_DNSWL_LOW(-0.10)[101.4.254.178.list.dnswl.org : 127.0.5.1]; RECEIVED_SPAMHAUS_PBL(0.00)[47.83.187.80.zen.spamhaus.org : 127.0.0.10]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:42730, ipnet:178.254.0.0/19, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[unixarea.de]; AUTH_NA(1.00)[]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 18:22:51 -0000 El día domingo, julio 14, 2019 a las 07:44:16p. m. +0200, Polytropon escribió: > Why doesn't it seem to occur to people that this sounds entirely wrong? > It's not that it is impossible, or doesn't work - but shouldn't it be > much easier to copy _your_ photos from _your_ phone without requiring > a 3rd party app, registering for a crappy cloud service, or mess with > "developer settings"? > > In my opinion, it should be as easy as attaching the USB cable and > then immediately having access to a direct access mass storage, as > per the standard. Mount it, copy your files, unmount it, done. No > need for apps and cloud nonsense. Of course, using an MTP interface > is also easy, and with GUI tools like gtkam, access is super easy. > It should work that way by default, with cable. > > Why do manufacturers think it's okay to make things needlessly > complicated? I mean... I even got this working with an iPad, so > why should an Android-based phone, where Android is usually considered > "some kind of Linux", force you to do annoying things? I think with > the tools available on FreeBSD, it should be possible to get images > copied from an Android phone without much messing with that phone. I slightly disagree. A Linux based mobile device should behave like this. It should present itself via SSH and allow access to your photos with scp or rsync+ssh, and if you need some GUI, use something of KDE or Gnome which works on top of SSH to present the dirs and files in a Norton Commander style. My Ubuntu mobile device works like this (and I do use rsync and ssh/scp all days). The Android based mobiles *could* behave the same way, but Google does not want this and want that the user uses something else, for example some cloud. The upcoming Puri.sm L5 will also be a normal Linux system. I'm awaiting mine in Q3 of this year. matthias -- Matthias Apitz, ✉ guru@unixarea.de, http://www.unixarea.de/ +49-176-38902045 Public GnuPG key: http://www.unixarea.de/key.pub May, 9: Спаси́бо освободители! Thank you very much, Russian liberators! From owner-freebsd-questions@freebsd.org Sun Jul 14 18:55:49 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 64789A35E2 for ; Sun, 14 Jul 2019 18:55:49 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from ms-10.1blu.de (ms-10.1blu.de [178.254.4.101]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id B7B0F87BFB for ; Sun, 14 Jul 2019 18:55:48 +0000 (UTC) (envelope-from guru@unixarea.de) Received: from [80.187.83.47] (helo=localhost.unixarea.de) by ms-10.1blu.de with esmtpsa (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.86_2) (envelope-from ) id 1hmjez-0008Dn-53; Sun, 14 Jul 2019 20:55:45 +0200 Received: from localhost.my.domain (localhost [127.0.0.1]) by localhost.unixarea.de (8.15.2/8.14.9) with ESMTPS id x6EIti00002793 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 14 Jul 2019 20:55:44 +0200 (CEST) (envelope-from guru@unixarea.de) Received: (from guru@localhost) by localhost.my.domain (8.15.2/8.14.9/Submit) id x6EIthGG002792; Sun, 14 Jul 2019 20:55:43 +0200 (CEST) (envelope-from guru@unixarea.de) X-Authentication-Warning: localhost.my.domain: guru set sender to guru@unixarea.de using -f Date: Sun, 14 Jul 2019 20:55:43 +0200 From: Matthias Apitz To: Polytropon , "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Message-ID: <20190714185543.GA2740@c720-r342378> Reply-To: Matthias Apitz Mail-Followup-To: Polytropon , "freebsd-questions@freebsd.org" References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> <20190714182245.GA2405@c720-r342378> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <20190714182245.GA2405@c720-r342378> X-Operating-System: FreeBSD 13.0-CURRENT r342378 (amd64) X-message-flag: Mails containing HTML will not be read! Please send only plain text. User-Agent: Mutt/1.11.1 (2018-12-01) X-Con-Id: 51246 X-Con-U: 0-guru X-Originating-IP: 80.187.83.47 X-Rspamd-Queue-Id: B7B0F87BFB X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-3.58 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XOIP(0.00)[]; TO_DN_SOME(0.00)[]; HAS_REPLYTO(0.00)[guru@unixarea.de]; IP_SCORE(-2.95)[ip: (-8.63), ipnet: 178.254.0.0/19(-3.48), asn: 42730(-2.61), country: DE(-0.01)]; HAS_XAW(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[cached: mail.unixarea.de]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.93)[-0.927,0]; RCVD_IN_DNSWL_LOW(-0.10)[101.4.254.178.list.dnswl.org : 127.0.5.1]; RECEIVED_SPAMHAUS_PBL(0.00)[47.83.187.80.zen.spamhaus.org : 127.0.0.10]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:42730, ipnet:178.254.0.0/19, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[unixarea.de]; AUTH_NA(1.00)[]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 18:55:49 -0000 El día domingo, julio 14, 2019 a las 08:22:45p. m. +0200, Matthias Apitz escribió: > I slightly disagree. A Linux based mobile device should behave like > this. It should present itself via SSH and allow access to your photos > with scp or rsync+ssh, and if you need some GUI, use something of KDE or > Gnome which works on top of SSH to present the dirs and files in a > Norton Commander style. My Ubuntu mobile device works like this (and I > do use rsync and ssh/scp all days). The Android based mobiles *could* > behave the same way, but Google does not want this and want that the > user uses something else, for example some cloud. The upcoming Puri.sm > L5 will also be a normal Linux system. I'm awaiting mine in Q3 of this > year. I write my diary in my FreeBSD laptop and when I'm done with the day actual, like now, I do rsync the HTML file and pictures to my phone to have it there in a browser as well: $ ./rsyncBQ.sh + cd /home/guru/diario2019 + rsync -rav -c --no-owner diario.html enanitos imagenes phablet@172.20.10.3:/media/phablet/6464-6631/diario2019 Enter passphrase for key '/home/guru/.ssh/id_rsa': sending incremental file list diario.html enanitos/ enanitos/download_257119696_372401.jpg enanitos/download_263708495_67069.jpg enanitos/image20180922_154043059.jpg imagenes/ imagenes/Anzeigen_2019-27___Unsere_Zeit.pdf imagenes/download_257119696_372401.jpg imagenes/download_263708495_67069.jpg imagenes/image20180922_154043059.jpg sent 11,657,646 bytes received 699 bytes 337,923.04 bytes/sec total size is 63,508,815 speedup is 5.45 Nothing magic, only UNIX. The connection was done via Wifi through the AP both devices are connected to, the FreeBSD laptop and the Ubuntu phone. matthias -- Matthias Apitz, ✉ guru@unixarea.de, http://www.unixarea.de/ +49-176-38902045 Public GnuPG key: http://www.unixarea.de/key.pub May, 9: Спаси́бо освободители! Thank you very much, Russian liberators! From owner-freebsd-questions@freebsd.org Sun Jul 14 20:16:25 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1CA36A5212 for ; Sun, 14 Jul 2019 20:16:25 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id D673B8AA7A for ; Sun, 14 Jul 2019 20:16:22 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:a239:3b2a:b87c:acc3:80ff:2493] (unknown [172.58.142.147]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id D97D44F9E5; Sun, 14 Jul 2019 15:16:15 -0500 (CDT) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 12.4 \(3445.104.11\)) Subject: Re: How to explore Android device files under FreeBSD ? From: Valeri Galtsev In-Reply-To: <20190714182245.GA2405@c720-r342378> Date: Sun, 14 Jul 2019 15:19:46 -0500 Cc: Polytropon , "freebsd-questions@freebsd.org" Content-Transfer-Encoding: quoted-printable Message-Id: <426C3390-6DA4-4B9D-98B7-AD1831027320@kicp.uchicago.edu> References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> <20190714182245.GA2405@c720-r342378> To: Matthias Apitz X-Mailer: Apple Mail (2.3445.104.11) X-Rspamd-Queue-Id: D673B8AA7A X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dmarc=fail reason="" header.from=uchicago.edu (policy=none) X-Spamd-Result: default: False [1.19 / 15.00]; ARC_NA(0.00)[]; TO_DN_EQ_ADDR_SOME(0.00)[]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none]; RCVD_VIA_SMTP_AUTH(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; MV_CASE(0.50)[]; NEURAL_HAM_LONG(-0.34)[-0.344,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; NEURAL_HAM_MEDIUM(-0.50)[-0.497,0]; TO_DN_SOME(0.00)[]; NEURAL_SPAM_SHORT(0.46)[0.456,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[kicp.uchicago.edu]; RCVD_IN_DNSWL_NONE(0.00)[70.20.135.128.list.dnswl.org : 127.0.10.0]; R_SPF_NA(0.00)[]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; MID_RHS_MATCH_FROM(0.00)[]; IP_SCORE(-0.01)[country: US(-0.06)]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 20:16:25 -0000 > On Jul 14, 2019, at 1:22 PM, Matthias Apitz wrote: >=20 > El d=C3=ADa domingo, julio 14, 2019 a las 07:44:16p. m. +0200, = Polytropon escribi=C3=B3: >=20 >> Why doesn't it seem to occur to people that this sounds entirely = wrong? >> It's not that it is impossible, or doesn't work - but shouldn't it be >> much easier to copy _your_ photos from _your_ phone without requiring >> a 3rd party app, registering for a crappy cloud service, or mess with >> "developer settings"? >>=20 >> In my opinion, it should be as easy as attaching the USB cable and >> then immediately having access to a direct access mass storage, as >> per the standard. Mount it, copy your files, unmount it, done. No >> need for apps and cloud nonsense. Of course, using an MTP interface >> is also easy, and with GUI tools like gtkam, access is super easy. >> It should work that way by default, with cable. >>=20 >> Why do manufacturers think it's okay to make things needlessly >> complicated? I mean... I even got this working with an iPad, so >> why should an Android-based phone, where Android is usually = considered >> "some kind of Linux", force you to do annoying things? I think with >> the tools available on FreeBSD, it should be possible to get images >> copied from an Android phone without much messing with that phone. >=20 > I slightly disagree. A Linux based mobile device should behave like > this. As a matter of fact, Android by no means should be considered =E2=80=9CLin= ux based=E2=80=9D. (Maemo was one). Even though google used Linux = kernel, but to that they have added big chunk of proprietary code, and = whoever says what that code does will go to prison. Even worse, android = system based devices are designed be more and more resilient to = attempts to reflash onto them with =E2=80=9Cde-googled=E2=80=9D android = clones. I=E2=80=99ve been there recently, and after some time I ended up = removing LineageOS and going back to whatever device vendor shipped = device with. And I do not accept the label of "moron who wasn=E2=80=99t = able to flash another system" (especially after I recovered a couple of = times from HARD bricked state). Google invested a ton of [? Uncounted and unaccounted for taxpayer=E2=80=99= s money ?] into collection of information. It is even deeper task than = brainwashing not only of zombies walking looking into their smart = devices, but everybody. Windows insists on using their browser, and = feeds =E2=80=9Cnews=E2=80=9D selected by them, Mozilla with Firerefox = feeds everyone through their =E2=80=9Cpocket=E2=80=9D, and so on. Yes, = you can tune away the garbage that is on by default, but those of you = who do do not matter as you are resilient to brainwashing anyway. It is = the majority who don=E2=80=99t care that matter, as they will be the = ones who praise =E2=80=9CDemocracy=E2=80=9D which (opposed to = Constitutional Republic) is a dictatorship (of majority over minority). = And this majority will define though democracy what the future will be. = So, brainwashing is tremendously important task. Why do you think the = government is using my taxpayers money for programs to get everyone (who = can not afford to buy one) smart phones. Collection of information is yet even more important. And google = definitely will do everything to guard the return they expect to have on = their investment. Think if independence of American states from Britain = would be successfully achieved if google existed (and was available for = Britain) back then. And yes, everyone who even asks the above questions, not even suggests = answers is usually labeled as =E2=80=9Cconspiracy theorist=E2=80=9D. So, = use your brain while you are not labelling yourself that for thinking = about these matters ;-) Valeri=20 > It should present itself via SSH and allow access to your photos > with scp or rsync+ssh, and if you need some GUI, use something of KDE = or > Gnome which works on top of SSH to present the dirs and files in a > Norton Commander style. My Ubuntu mobile device works like this (and I > do use rsync and ssh/scp all days). The Android based mobiles *could* > behave the same way, but Google does not want this and want that the > user uses something else, for example some cloud. The upcoming Puri.sm > L5 will also be a normal Linux system. I'm awaiting mine in Q3 of this > year. >=20 > matthias >=20 >=20 > --=20 > Matthias Apitz, =E2=9C=89 guru@unixarea.de, http://www.unixarea.de/ = +49-176-38902045 > Public GnuPG key: http://www.unixarea.de/key.pub > May, 9: =D0=A1=D0=BF=D0=B0=D1=81=D0=B8=CC=81=D0=B1=D0=BE = =D0=BE=D1=81=D0=B2=D0=BE=D0=B1=D0=BE=D0=B4=D0=B8=D1=82=D0=B5=D0=BB=D0=B8! = Thank you very much, Russian liberators! > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Sun Jul 14 20:31:59 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id F1B6BA5767 for ; Sun, 14 Jul 2019 20:31:59 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 212838B269 for ; Sun, 14 Jul 2019 20:31:58 +0000 (UTC) (envelope-from kremels@kreme.com) From: "@lbutlr" Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Subject: Re: How to explore Android device files under FreeBSD ? Date: Sun, 14 Jul 2019 14:31:51 -0600 References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> To: freebsd-questions@freebsd.org In-Reply-To: <20190714194416.6948d301.freebsd@edvax.de> Message-Id: <79F8B462-3D48-466C-B9AF-6EA6188E838E@kreme.com> X-Mailer: Apple Mail (2.3445.104.11) X-Rspamd-Queue-Id: 212838B269 X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [1.90 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.21)[-0.210,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MISSING_MIME_VERSION(2.00)[]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-0.25)[-0.247,0]; DMARC_NA(0.00)[kreme.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MX_GOOD(-0.01)[cached: mail.covisp.net]; NEURAL_SPAM_SHORT(0.02)[0.021,0]; IP_SCORE(-0.25)[ip: (-0.89), ipnet: 65.112.0.0/12(-0.31), asn: 209(-0.01), country: US(-0.06)]; RCVD_COUNT_ZERO(0.00)[0]; RCVD_IN_DNSWL_LOW(-0.10)[42.55.121.65.list.dnswl.org : 127.0.5.1]; R_DKIM_NA(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 20:32:00 -0000 > On 14 Jul 2019, at 11:44, Polytropon wrote: >=20 > On Sun, 14 Jul 2019 01:34:46 +0200, Kjell Tore Ullavik wrote: >> One simple way is to just install and start a ftp-server app on your = phone. >=20 >=20 > On Sat, 13 Jul 2019 19:36:08 -0400, Vlad D. Markov wrote: >> I gave up on connecting via cabling. I installed an app that made >> my phone an ftp server then I ftped the files onto my computer. >=20 >=20 >=20 > Why doesn't it seem to occur to people that this sounds entirely = wrong? > It's not that it is impossible, or doesn't work - but shouldn't it be > much easier to copy _your_ photos from _your_ phone without requiring > a 3rd party app, registering for a crappy cloud service, or mess with > "developer settings=E2=80=9D? It is easier on a supported OS. > In my opinion, it should be as easy as attaching the USB cable and > then immediately having access to a direct access mass storage, as > per the standard. Oh sure, Android COULD do this, but they have no motivation to do so. > Why do manufacturers think it's okay to make things needlessly > complicated? The main reasons are 1) to squeeze money out of you or 2) incompetence. = It is often difficult to tell which one is at play. > I mean... I even got this working with an iPad because it is easier on an iPad and the camera roll shows up as a mass = storage device? (not on macOS, granted, but last time I did this (years = ago) on a FreeBSD machine I plugged in the device, mounted it, copied = the photos out of the DCIM folder, and dismounted it. > , so > why should an Android-based phone, where Android is usually considered > "some kind of Linux=E2=80=9D, Isn=E2=80=99t it really Java running on a bare bare bare linux kernel? = There=E2=80=99s no real linux there. > force you to do annoying things? I think with > the tools available on FreeBSD, it should be possible to get images > copied from an Android phone without much messing with that phone. Should? Perhaps. I don=E2=80=99t think it is though. --=20 Elves are wonderful. They provoke wonder. Elves are marvelous. They cause marvels. Elves are fantastic. They create fantasies. Elves are glamorous. They project glamour. Elves are enchanting. They weave enchantment. Elves are terrific. They beget terror. From owner-freebsd-questions@freebsd.org Sun Jul 14 20:37:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5816EA5A98 for ; Sun, 14 Jul 2019 20:37:08 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) Received: from EUR02-HE1-obe.outbound.protection.outlook.com (mail-oln040092068083.outbound.protection.outlook.com [40.92.68.83]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 0354C8B741 for ; Sun, 14 Jul 2019 20:37:05 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=1jqOrdU1F6W4qiymqRI5FewaKa82lMQ8PxCmcMBcljk=; b=gOEo8FnfmA9o5UTlMFMrrXYmPhT7wyh6TSSZ903fVEYUrgwJaF7Kc28hLW19a1L16yZHOA6emvuXJ/Hce5JEW/maucrOmcEa9tszawlGJnqdXbi+aHB2rp9fuOhqtialRWnKLMsGMcE5mOGPE0Dzbu09Afwjfrx8rjvvtBQuexV9qMwXdu35pEUAnDV8fskblVsTQHNtIGGP9r9tNzWJSdWLKaMI1JZFE8MropSSZacboEIWuJBkqShiWIiBHVS4dtEiG+0IOrHSlnvURcm8owJMZszGFGnCoeNFtyayH7iqhZI8k1hYaE0dR1s1CM1KP/dMtSLcjILnyqU0frQUDw== Received: from VE1EUR02FT052.eop-EUR02.prod.protection.outlook.com (10.152.12.57) by VE1EUR02HT187.eop-EUR02.prod.protection.outlook.com (10.152.13.47) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.19; Sun, 14 Jul 2019 20:37:03 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com (10.152.12.55) by VE1EUR02FT052.mail.protection.outlook.com (10.152.13.146) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.19 via Frontend Transport; Sun, 14 Jul 2019 20:37:03 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a]) by AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a%7]) with mapi id 15.20.2073.012; Sun, 14 Jul 2019 20:37:03 +0000 From: Manish Jain To: "Lena@lena.kiev.ua" , "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Thread-Topic: How to explore Android device files under FreeBSD ? Thread-Index: AQHVOau0SaNbxoeM0kCCsC7DTHlOV6bKFM8AgAB/zAA= Date: Sun, 14 Jul 2019 20:37:03 +0000 Message-ID: References: <20190714130014.GG787@lena.kiev> In-Reply-To: <20190714130014.GG787@lena.kiev> Accept-Language: en-GB, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-clientproxiedby: PN1PR01CA0109.INDPRD01.PROD.OUTLOOK.COM (2603:1096:c00::25) To AM0PR03MB4594.eurprd03.prod.outlook.com (2603:10a6:208:c8::27) x-incomingtopheadermarker: OriginalChecksum:7AF371B5E617B3103B7E3B60729BE3E937EAA1E8DBC26DF10292CAAD2A573F0D; UpperCasedChecksum:A297546F7244DA306CD0BA92DD41B6730FA783750AF93E11873F5960B5671BF5; SizeAsReceived:7428; Count:48 x-ms-exchange-messagesentrepresentingtype: 1 x-tmn: [bdmta0Ig2hrqmL6LY83JFa90hwMZaok4] x-microsoft-original-message-id: <5673db8d-c235-30fa-2e0f-b297ff1cf36b@hotmail.com> x-ms-publictraffictype: Email x-incomingheadercount: 48 x-eopattributedmessage: 0 x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(5050001)(7020095)(20181119110)(201702061078)(5061506573)(5061507331)(1603103135)(2017031320274)(2017031322404)(2017031323274)(2017031324274)(1601125500)(1603101475)(1701031045); SRVR:VE1EUR02HT187; x-ms-traffictypediagnostic: VE1EUR02HT187: x-ms-exchange-purlcount: 1 x-microsoft-antispam-message-info: AFpU66oUQX5hIfh7B+1VvqPr5pJ3WPC7e9Kup+3OBdUJ6IVIyvT/Ucr+mxx4TVDTF1wYD+wqeurtDhQ6CdvKKW784wJrLDPpQU2X2t1lDVGyUTjhxJ7A8Gw7iDiMQFwFS0aozt585CSRuP8SgBvuFkwUYXBtzntpH2e5AAr9FPWAZGkndN/dsEpzg5fnoft/ Content-Type: text/plain; charset="utf-8" Content-ID: <0D6EBF476A1A0746BCEE94EE974FE1C5@eurprd03.prod.outlook.com> Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-OriginatorOrg: hotmail.com X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-Network-Message-Id: 03ac2c28-38a8-482e-2e37-08d7089b073f X-MS-Exchange-CrossTenant-rms-persistedconsumerorg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-originalarrivaltime: 14 Jul 2019 20:37:03.6155 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Internet X-MS-Exchange-CrossTenant-id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-Transport-CrossTenantHeadersStamped: VE1EUR02HT187 X-Rspamd-Queue-Id: 0354C8B741 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=gOEo8Fnf; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of bourne.identity@hotmail.com designates 40.92.68.83 as permitted sender) smtp.mailfrom=bourne.identity@hotmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; R_SPF_ALLOW(-0.20)[+ip4:40.92.0.0/15]; FREEMAIL_FROM(0.00)[hotmail.com]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[hotmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; RCPT_COUNT_TWO(0.00)[2]; MX_GOOD(-0.01)[hotmail-com.olc.protection.outlook.com,hotmail-com.olc.protection.outlook.com]; MIME_BASE64_TEXT(0.10)[]; NEURAL_HAM_SHORT(-0.56)[-0.560,0]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; ASN(0.00)[asn:8075, ipnet:40.64.0.0/10, country:US]; DWL_DNSWL_NONE(0.00)[hotmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[83.68.92.40.list.dnswl.org : 127.0.3.0]; TO_DN_EQ_ADDR_ALL(0.00)[]; IP_SCORE(-1.03)[ipnet: 40.64.0.0/10(-2.91), asn: 8075(-2.20), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 20:37:08 -0000 SGkgTGVuYS9vdGhlcnMsDQoNCg0KSSB0cmllZCBmb2xsb3dpbmcgeW91ciBzaW1wbGlzdGljIHNv bHV0aW9uLiBCdXQgaW5zdGVhZCBvZiBhIGRpcmVjdG9yeSANCm5hbWVkIENhbWVyYXMsIEkgZ2V0 IHRoaXM6DQoNCg0KTElCVVNCX0ZVTkNUSU9OOiBsaWJ1c2JfYnVsa190cmFuc2ZlciBsZWF2ZQ0K eW91ciBkZXZpY2UgbWF5IGJlIGxvY2tlZCBvciBkb2VzIG5vdCBoYXZlIGFueSBzdG9yYWdlIGF2 YWlsYWJsZQ0KDQoNCkkgZG8gbm90IGtub3cgd2hhdCB0aGF0IG1lYW5zLiBJIGhhdmUgJ09FTSB1 bmxvY2tpbmcnIGVuYWJsZWQgaW4gDQpEZXZlbG9wZXIgT3B0aW9ucywgYW5kICdVU0IgZGVidWdn aW5nJyBlbmFibGVkIGluIFNldHRpbmdzLiBTbyBob3cgZG8gSSANCnVubG9jayB0aGUgcGhvbmUg Pw0KDQoNCk15IHBob25lIGlzIGEgTW90b3JvbGEgcGhvbmUgcHVyY2hhc2VkIHJvdWdobHkgNSB5 ZWFycyBiYWNrLg0KDQoNClRoYW5rIHlvdSAmIFJlZ2FyZHMsDQpNYW5pc2ggSmFpbg0KDQpPbiAy MDE5LTA3LTE0IDE4OjMwLCBMZW5hQGxlbmEua2lldi51YSB3cm90ZToNCj4+IFNvbWVib2R5IGhh cyBhc2tlZCBtZSBmb3Igc29tZSBpbWFnZXMgb24gbXkgQW5kcm9pZCBwaG9uZS4NCj4+IFNvIEkg Zmlyc3QgbmVlZCB0byBkb3dubG9hZCB0aG9zZSBmaWxlcyBmcm9tIHRoZSBwaG9uZSB0byBteSBG cmVlQlNEIGJveA0KPiBwa2cgaW5zdGFsbCBhbmRyb2lkLWZpbGUtdHJhbnNmZXINCj4NCj4gSW4g L2V0Yy9kZXZmcy5ydWxlcyBhbGxvdyB5b3VyIHVzdWFsIHVzZXIgYWNjZXNzIHRvIFVTQjoNCj4N Cj4gW2xvY2FscnVsZXM9MTBdDQo+IGFkZCBwYXRoICd1Z2VuKicgbW9kZSAwNjYwIGdyb3VwIHlv dXJncm91cA0KPiBhZGQgcGF0aCAndXNiPyonIG1vZGUgMDY2MCBncm91cCB5b3VyZ3JvdXANCj4g YWRkIHBhdGggJ3VzYi8qJyBtb2RlIDA2NjAgZ3JvdXAgeW91cmdyb3VwDQo+DQo+IEFzIHRoYXQg dXNlcjoNCj4gYWZ0LW10cC1jbGkgImNkIERDSU0iICJnZXQgQ2FtZXJhIg0KPg0KPiBUaGF0IGNy ZWF0ZXMgZGlyZWN0b3J5ICdDYW1lcmEnIGFuZCBkb3dubG9hZHMgcGhvdG9zIGludG8gaXQuDQo+ DQo+IF9fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fX19fDQo+IGZy ZWVic2QtcXVlc3Rpb25zQGZyZWVic2Qub3JnIG1haWxpbmcgbGlzdA0KPiBodHRwczovL2xpc3Rz LmZyZWVic2Qub3JnL21haWxtYW4vbGlzdGluZm8vZnJlZWJzZC1xdWVzdGlvbnMNCj4gVG8gdW5z dWJzY3JpYmUsIHNlbmQgYW55IG1haWwgdG8gImZyZWVic2QtcXVlc3Rpb25zLXVuc3Vic2NyaWJl QGZyZWVic2Qub3JnIg0K From owner-freebsd-questions@freebsd.org Sun Jul 14 20:42:02 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1B3E9A5EF6 for ; Sun, 14 Jul 2019 20:42:02 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) Received: from EUR03-DB5-obe.outbound.protection.outlook.com (mail-db5eur03olkn0800.outbound.protection.outlook.com [IPv6:2a01:111:f400:fe0a::800]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 8BD738BC27 for ; Sun, 14 Jul 2019 20:42:00 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=HfwHSbH4twAsbn1yKyWMn/T2kHsRZkG2K38THtxP67k=; b=B3Q0rWoPpqpLSy4yV6jwgtuiDQ+BxlqKtD1o26kgmRwSj3qi1PYEUKcTjBLSdrb41Yy8njEXkSKvrkZwylnlGCjaHYIcNr49RP7/6gdh2Eup6GaI0v6CnmqZN0iQurxQkio3qxeN8t3O16W3S1a9j08SJmjENneUXwtvZ0Cu2163TDev53cxvWnJvtQY8NCL+l8gAjcCIcIVgyYL+xe3c40BjURq6dLCiMoVdQSPWPTy6nlnY/LgrqcAAdiiEnnAO94sPLO7Zb2AvKVRw42AVr+XSNVTA1Ivx96JRbYnxvhDK/GtvecXU6JLQU6aGr/2uHZmRJD29d43XvAVCjSnRQ== Received: from VE1EUR03FT003.eop-EUR03.prod.protection.outlook.com (10.152.18.58) by VE1EUR03HT030.eop-EUR03.prod.protection.outlook.com (10.152.18.171) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.18; Sun, 14 Jul 2019 20:41:58 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com (10.152.18.59) by VE1EUR03FT003.mail.protection.outlook.com (10.152.18.108) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.18 via Frontend Transport; Sun, 14 Jul 2019 20:41:58 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a]) by AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a%7]) with mapi id 15.20.2073.012; Sun, 14 Jul 2019 20:41:58 +0000 From: Manish Jain To: Anders Jensen-Waud , "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Thread-Topic: How to explore Android device files under FreeBSD ? Thread-Index: AQHVOau0SaNbxoeM0kCCsC7DTHlOV6bJrViAgADoogA= Date: Sun, 14 Jul 2019 20:41:58 +0000 Message-ID: References: <6b6670c9-277b-e874-f82b-dcaa38fa82a4@jensenwaud.com> In-Reply-To: <6b6670c9-277b-e874-f82b-dcaa38fa82a4@jensenwaud.com> Accept-Language: en-GB, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-clientproxiedby: BM1PR0101CA0064.INDPRD01.PROD.OUTLOOK.COM (2603:1096:b00:19::26) To AM0PR03MB4594.eurprd03.prod.outlook.com (2603:10a6:208:c8::27) x-incomingtopheadermarker: OriginalChecksum:0BFF44AED5B16C3F54F44E62D33D36E66E7659937FA7379BC3C926E9F59121EB; UpperCasedChecksum:0E60AFF3B32E91D7E20020EDA687234D67F611873F4F16FF4C1A8530E996DB10; SizeAsReceived:7543; Count:48 x-ms-exchange-messagesentrepresentingtype: 1 x-tmn: [3PbMxuI5cfuO+gMUcwLCPlB/hHYh6DaN] x-microsoft-original-message-id: <0f9f70f7-e9f5-8fcd-64f6-b24534f1e242@hotmail.com> x-ms-publictraffictype: Email x-incomingheadercount: 48 x-eopattributedmessage: 0 x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(5050001)(7020095)(20181119110)(201702061078)(5061506573)(5061507331)(1603103135)(2017031320274)(2017031322404)(2017031323274)(2017031324274)(1601125500)(1603101475)(1701031045); SRVR:VE1EUR03HT030; x-ms-traffictypediagnostic: VE1EUR03HT030: x-microsoft-antispam-message-info: fR9GWD1MhFO9bScuHxuYQnqSv5xBTTigbZqstPu7ZmD4XOYcAJSEDECFcsqBG6Io/4CPhR/zSJoos9Z1heAPtesK0aa1YpwRmCTE9Q1PYTlJhcWTMWUaiSFgP6OszhZaZOpNuwXX4OO4K/SOiV0kjy8ahr8acAhHuhw/Y3C/v3g64YG4+rbukOBvVfrWZsrn Content-Type: text/plain; charset="utf-8" Content-ID: <58B29F4CB780BB409BB94B63DCF7F31F@eurprd03.prod.outlook.com> Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-OriginatorOrg: hotmail.com X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-Network-Message-Id: 1fb7185a-00d3-49b0-ac55-08d7089bb70f X-MS-Exchange-CrossTenant-rms-persistedconsumerorg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-originalarrivaltime: 14 Jul 2019 20:41:58.3583 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Internet X-MS-Exchange-CrossTenant-id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-Transport-CrossTenantHeadersStamped: VE1EUR03HT030 X-Rspamd-Queue-Id: 8BD738BC27 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=B3Q0rWoP; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of bourne.identity@hotmail.com designates 2a01:111:f400:fe0a::800 as permitted sender) smtp.mailfrom=bourne.identity@hotmail.com X-Spamd-Result: default: False [-3.34 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a01:111:f400::/48]; FREEMAIL_FROM(0.00)[hotmail.com]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[hotmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; MIME_BASE64_TEXT(0.10)[]; MX_GOOD(-0.01)[cached: hotmail-com.olc.protection.outlook.com]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; NEURAL_HAM_SHORT(-0.46)[-0.456,0]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; ASN(0.00)[asn:8075, ipnet:2a01:111:f000::/36, country:US]; DWL_DNSWL_NONE(0.00)[hotmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[0.0.8.0.0.0.0.0.0.0.0.0.0.0.0.0.a.0.e.f.0.0.4.f.1.1.1.0.1.0.a.2.list.dnswl.org : 127.0.3.0]; IP_SCORE(-0.97)[ipnet: 2a01:111:f000::/36(-2.59), asn: 8075(-2.20), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 20:42:02 -0000 SGkgQW5kZXJzLA0KDQoNCkkgaW5zdGFsbGVkIGZ1c2Vmcy1zaW1wbGUtbXRwZnMsIGJ1dCBoYXZl IG5vIGlkZWEgaG93IHRvIHRha2UgaXQgZnJvbSANCnRoZXJlIG9uLiBDb3VsZCB5b3UgcGVyaGFw cyBwcm92aWRlIGNvbW1hbmRzIGZvciBhIHdob2xlc29tZSBzb2x1dGlvbiA/DQoNCg0KVGhhbmsg eW91ICYgUmVnYXJkcywNCk1hbmlzaCBKYWluDQoNCk9uIDIwMTktMDctMTQgMTI6MTksIEFuZGVy cyBKZW5zZW4tV2F1ZCB3cm90ZToNCj4NCj4gT24gMTQvNy8xOSA0OjQ5IGFtLCBNYW5pc2ggSmFp biB3cm90ZToNCj4+IElzIHRoZXJlIHNvbWUgd2F5IEkgY2FuIGRvIHRoYXQgPw0KPj4NCj4+DQo+ PiBNeSBBbmRyb2lkIHBob25lIGRvZXMgbm90IGhhdmUgYSBVU0IgcG9ydCwgYnV0IGl0IGRvZXMg aGF2ZSBhIG1pY3JvIFVTQg0KPj4gcG9ydCAod2hpY2ggSSB1c2UgZm9yDQo+Pg0KPj4gY2hhcmdp bmcgdGhlIHBob25lKS4NCj4NCj4gSSBoYXZlIHVzZWQgRlVTRSB0byBkb3dubG9hZCBwaG90b3Mg ZnJvbSBteSBBbmRyb2lkIHBob25lIGNvbm5lY3RlZCANCj4gdmlhIGEgbWljcm8tVVNCIHRvIFVT QiBjYWJsZS4gT25jZSBjb25uZWN0ZWQgdG8gbXkgRnJlZUJTRCBib3gsIEkgDQo+IGVuYWJsZWQg TVRQIGFuZCBJIGNvdWxkIHVzZSBGVVNFIHRvIGFjY2VzcyBpdCBzaW1pbGFyIHRvIGEgZGlnaXRh bCANCj4gY2FtZXJhLg0KPg0KPiBGcm9tIG1lbW9yeSBpdCB3YXMgdXNpbmcgdGhlIHBhY2thZ2Ug J2Z1c2Vmcy1zaW1wbGUtbXRwZnMtMC4zLjBfNCcuDQo+DQo+IEJlc3QNCj4NCj4gQW5kZXJzDQo+ DQo= From owner-freebsd-questions@freebsd.org Sun Jul 14 20:58:18 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7DB3FA627D for ; Sun, 14 Jul 2019 20:58:18 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) Received: from EUR03-AM5-obe.outbound.protection.outlook.com (mail-oln040092070082.outbound.protection.outlook.com [40.92.70.82]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 70E748C2BC for ; Sun, 14 Jul 2019 20:58:17 +0000 (UTC) (envelope-from bourne.identity@hotmail.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=fGH2o7ImVNgKtKJi+++GbWjpKe7/hYiDOvibkOIqZ74=; b=rArsxEF30o5lX3tVtL5o96i1M0aSp9223Aut3UwS7jrAirGZ4yygFHPIxjiCGoSYpW/smmmS6yWSgF2gGyxZiQ+6JXaJq8NozQvZBpO8Y8TTDWxtyCwx7iqriEZdqIfvizR/NNGWLkVfiMt0zkyvt8fWZDoJONLheGnrpfmKtX24v+1yTREx+mDPBdLh5rdf6djGg0XxAdl7IvedswL2CkfKdQLG7iQN1UXCz/6YQgmDu8QrT2Fj5h/3Io8IWHn17dNcV6BSMzXNGZxITRWoKO/9KflGhizEKm9yTIyjkD/CZxvU65qckmTmKXtvSLJRIbFSmF/OpQqGMFloZzMwfw== Received: from AM5EUR03FT043.eop-EUR03.prod.protection.outlook.com (10.152.16.53) by AM5EUR03HT049.eop-EUR03.prod.protection.outlook.com (10.152.17.46) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.18; Sun, 14 Jul 2019 20:58:15 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com (10.152.16.53) by AM5EUR03FT043.mail.protection.outlook.com (10.152.17.43) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.2052.18 via Frontend Transport; Sun, 14 Jul 2019 20:58:15 +0000 Received: from AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a]) by AM0PR03MB4594.eurprd03.prod.outlook.com ([fe80::a56a:a97f:a030:242a%7]) with mapi id 15.20.2073.012; Sun, 14 Jul 2019 20:58:15 +0000 From: Manish Jain To: Polytropon , "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Thread-Topic: How to explore Android device files under FreeBSD ? Thread-Index: AQHVOau0SaNbxoeM0kCCsC7DTHlOV6bJM8QAgAEwZwCAADZdAA== Date: Sun, 14 Jul 2019 20:58:15 +0000 Message-ID: References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> In-Reply-To: <20190714194416.6948d301.freebsd@edvax.de> Accept-Language: en-GB, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-clientproxiedby: BM1PR01CA0138.INDPRD01.PROD.OUTLOOK.COM (2603:1096:b00:40::32) To AM0PR03MB4594.eurprd03.prod.outlook.com (2603:10a6:208:c8::27) x-incomingtopheadermarker: OriginalChecksum:E5BD7C74ACA8EA943DCFCE2065CACF50230E3B979E097352E16C1D2748765889; UpperCasedChecksum:CC4E76AD5994FED62CE73324DEDBA7F96540E9093ECC4DE71CD8AE228E63EB07; SizeAsReceived:7577; Count:48 x-ms-exchange-messagesentrepresentingtype: 1 x-tmn: [rdj/dO8UuIA43LyJr+KzI/nWdSHSvWJK] x-microsoft-original-message-id: x-ms-publictraffictype: Email x-incomingheadercount: 48 x-eopattributedmessage: 0 x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(5050001)(7020095)(20181119110)(201702061078)(5061506573)(5061507331)(1603103135)(2017031320274)(2017031324274)(2017031323274)(2017031322404)(1601125500)(1603101475)(1701031045); SRVR:AM5EUR03HT049; x-ms-traffictypediagnostic: AM5EUR03HT049: x-ms-exchange-purlcount: 1 x-microsoft-antispam-message-info: wFghD4Ber41p40OGb/y8xKvWcS7diVuvsaiWwxzEK/QisTBYSLDdy+Wt7Jzqj696C2icVBjdEA35X8QwzdJIqcC+3KykfTqHMc8Lqx4Qt6JqBv1btvw74+y6l9Ot5XvUGeTiVkdrUTOPQCoNFP7UelQGn7zgTgNvStf/xFUQC7FUAagMCEhCvr4v0FV1va+v Content-Type: text/plain; charset="utf-8" Content-ID: <5787E861E4C7704E88FA52EEAFE6298D@eurprd03.prod.outlook.com> Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-OriginatorOrg: hotmail.com X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-Network-Message-Id: 7461f87f-61d0-4a8e-b397-08d7089dfd75 X-MS-Exchange-CrossTenant-rms-persistedconsumerorg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-originalarrivaltime: 14 Jul 2019 20:58:15.5469 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Internet X-MS-Exchange-CrossTenant-id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-Transport-CrossTenantHeadersStamped: AM5EUR03HT049 X-Rspamd-Queue-Id: 70E748C2BC X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=rArsxEF3; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of bourne.identity@hotmail.com designates 40.92.70.82 as permitted sender) smtp.mailfrom=bourne.identity@hotmail.com X-Spamd-Result: default: False [-3.69 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:40.92.0.0/15]; FREEMAIL_FROM(0.00)[hotmail.com]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[cached: hotmail-com.olc.protection.outlook.com]; DKIM_TRACE(0.00)[hotmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.74)[-0.743,0]; MIME_BASE64_TEXT(0.10)[]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; ASN(0.00)[asn:8075, ipnet:40.64.0.0/10, country:US]; DWL_DNSWL_NONE(0.00)[hotmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[82.70.92.40.list.dnswl.org : 127.0.3.0]; IP_SCORE(-1.03)[ipnet: 40.64.0.0/10(-2.91), asn: 8075(-2.20), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 20:58:18 -0000 SGkgUG9seSwNCg0KDQpOb3RoaW5nIEkgaGF2ZSB0cmllZCBoYXMgd29ya2VkIHNvIGZhci4gQnV0 IEkgYW0gd2lsbGluZyB0byBzcGVuZCBhIGZldyANCmJ1Y2tzIHRvIHNldHRsZSB0aGlzIG9uY2Ug YW5kIGZvciBhbGwgKGNvbnNpZGVyaW5nIHRoYXQgRnJlZUJTRCBkb2VzIG5vdCANCnlldCBzdXBw b3J0IEJsdWV0b290aCBhZGFwdGVycykuDQoNCg0KTXkgcGhvbmUgaGFzIFdpRmkgY29ubmVjdGl2 aXR5IHRvby4gU28gaWYgSSBjYW4gZ2V0IGEgV2lGaSBhZGFwdGVyIHRoYXQgDQppcyBzdXBwb3J0 ZWQgdW5kZXIgRnJlZUJTRCwgSSBjb3VsZCBwZXJoYXBzIHRyYW5zZmVyIGZpbGVzIHZpYSB0aGF0 IHJvdXRlLg0KDQoNClF1ZXN0aW9uIGlzIDogaXMgdGhlcmUgYSBXaUZpIGFkYXB0ZXIgdGhhdCBp cyBzdXBwb3J0ZWQgdW5kZXIgRnJlZUJTRCBhcyANCndlbGwgYXMgYXZhaWxhYmxlIGF0IEFtYXpv biBJbmRpYSAoaHR0cHM6Ly93d3cuYW1hem9uLmluKSA/DQoNCg0KVGhhbmsgeW91ICYgUmVnYXJk cywNCk1hbmlzaCBKYWluDQoNCk9uIDIwMTktMDctMTQgMjM6MTQsIFBvbHl0cm9wb24gd3JvdGU6 DQo+IE9uIFN1biwgMTQgSnVsIDIwMTkgMDE6MzQ6NDYgKzAyMDAsIEtqZWxsIFRvcmUgVWxsYXZp ayB3cm90ZToNCj4+IE9uZSBzaW1wbGUgd2F5IGlzIHRvIGp1c3QgaW5zdGFsbCBhbmQgc3RhcnQg YSBmdHAtc2VydmVyIGFwcCBvbiB5b3VyIHBob25lLg0KPg0KPiBPbiBTYXQsIDEzIEp1bCAyMDE5 IDE5OjM2OjA4IC0wNDAwLCBWbGFkIEQuIE1hcmtvdiB3cm90ZToNCj4+IEkgZ2F2ZSB1cCBvbiBj b25uZWN0aW5nIHZpYSBjYWJsaW5nLiBJIGluc3RhbGxlZCBhbiBhcHAgdGhhdCBtYWRlDQo+PiBt eSBwaG9uZSBhbiBmdHAgc2VydmVyIHRoZW4gSSBmdHBlZCB0aGUgZmlsZXMgb250byBteSBjb21w dXRlci4NCj4NCj4NCj4gV2h5IGRvZXNuJ3QgaXQgc2VlbSB0byBvY2N1ciB0byBwZW9wbGUgdGhh dCB0aGlzIHNvdW5kcyBlbnRpcmVseSB3cm9uZz8NCj4gSXQncyBub3QgdGhhdCBpdCBpcyBpbXBv c3NpYmxlLCBvciBkb2Vzbid0IHdvcmsgLSBidXQgc2hvdWxkbid0IGl0IGJlDQo+IG11Y2ggZWFz aWVyIHRvIGNvcHkgX3lvdXJfIHBob3RvcyBmcm9tIF95b3VyXyBwaG9uZSB3aXRob3V0IHJlcXVp cmluZw0KPiBhIDNyZCBwYXJ0eSBhcHAsIHJlZ2lzdGVyaW5nIGZvciBhIGNyYXBweSBjbG91ZCBz ZXJ2aWNlLCBvciBtZXNzIHdpdGgNCj4gImRldmVsb3BlciBzZXR0aW5ncyI/DQo+DQo+IEluIG15 IG9waW5pb24sIGl0IHNob3VsZCBiZSBhcyBlYXN5IGFzIGF0dGFjaGluZyB0aGUgVVNCIGNhYmxl IGFuZA0KPiB0aGVuIGltbWVkaWF0ZWx5IGhhdmluZyBhY2Nlc3MgdG8gYSBkaXJlY3QgYWNjZXNz IG1hc3Mgc3RvcmFnZSwgYXMNCj4gcGVyIHRoZSBzdGFuZGFyZC4gTW91bnQgaXQsIGNvcHkgeW91 ciBmaWxlcywgdW5tb3VudCBpdCwgZG9uZS4gTm8NCj4gbmVlZCBmb3IgYXBwcyBhbmQgY2xvdWQg bm9uc2Vuc2UuIE9mIGNvdXJzZSwgdXNpbmcgYW4gTVRQIGludGVyZmFjZQ0KPiBpcyBhbHNvIGVh c3ksIGFuZCB3aXRoIEdVSSB0b29scyBsaWtlIGd0a2FtLCBhY2Nlc3MgaXMgc3VwZXIgZWFzeS4N Cj4gSXQgc2hvdWxkIHdvcmsgdGhhdCB3YXkgYnkgZGVmYXVsdCwgd2l0aCBjYWJsZS4NCj4NCj4g V2h5IGRvIG1hbnVmYWN0dXJlcnMgdGhpbmsgaXQncyBva2F5IHRvIG1ha2UgdGhpbmdzIG5lZWRs ZXNzbHkNCj4gY29tcGxpY2F0ZWQ/IEkgbWVhbi4uLiBJIGV2ZW4gZ290IHRoaXMgd29ya2luZyB3 aXRoIGFuIGlQYWQsIHNvDQo+IHdoeSBzaG91bGQgYW4gQW5kcm9pZC1iYXNlZCBwaG9uZSwgd2hl cmUgQW5kcm9pZCBpcyB1c3VhbGx5IGNvbnNpZGVyZWQNCj4gInNvbWUga2luZCBvZiBMaW51eCIs IGZvcmNlIHlvdSB0byBkbyBhbm5veWluZyB0aGluZ3M/IEkgdGhpbmsgd2l0aA0KPiB0aGUgdG9v bHMgYXZhaWxhYmxlIG9uIEZyZWVCU0QsIGl0IHNob3VsZCBiZSBwb3NzaWJsZSB0byBnZXQgaW1h Z2VzDQo+IGNvcGllZCBmcm9tIGFuIEFuZHJvaWQgcGhvbmUgd2l0aG91dCBtdWNoIG1lc3Npbmcg d2l0aCB0aGF0IHBob25lLg0KPg0KPg0KPg0K From owner-freebsd-questions@freebsd.org Sun Jul 14 21:21:06 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5F005A76B4 for ; Sun, 14 Jul 2019 21:21:06 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 71DE28DA04 for ; Sun, 14 Jul 2019 21:21:05 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1563139265; x=1565731265; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=8u8t/B0zZC2YUTYK8JqCyUsIC42LITeAPbOf+hA/ESA=; b=mJSk/IPWQ7J3oVlpPhLumgt8I8lpEtD2hIWKPlMyOpmYsJLa/pBnxOv48aYQCJ0w0IHIxVTWhsjmAeEy+skxeWOhDjhZXLe3pnelPvBLwSK0jvaX4IeTVguBfSgAEE48abuky9oQ9HBh1MmTSlWM2o5UYdo/X5JTiGai3hxuIDI= X-Thread-Info: NDI1MC4xMi4xYjUwMDAwMDI3OWJiNWUuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r2.us-west-2a.aws.in.socketlabs.com (r2.us-west-2a.aws.in.socketlabs.com [54.186.58.227]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 14 Jul 2019 17:20:58 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r2.us-west-2a.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 14 Jul 2019 17:20:57 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.91 (FreeBSD)) (envelope-from ) id 1hmlvT-000FCQ-EI for freebsd-questions@freebsd.org; Sun, 14 Jul 2019 22:20:55 +0100 Date: Sun, 14 Jul 2019 22:20:55 +0100 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: How to explore Android device files under FreeBSD ? Message-Id: <20190714222055.66bdc98838938a893ca4d8e4@sohara.org> In-Reply-To: <426C3390-6DA4-4B9D-98B7-AD1831027320@kicp.uchicago.edu> References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> <20190714182245.GA2405@c720-r342378> <426C3390-6DA4-4B9D-98B7-AD1831027320@kicp.uchicago.edu> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.0) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 71DE28DA04 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=mJSk/IPW; spf=pass (mx1.freebsd.org: domain of 4250.10.freebsd-questions=freebsd.org@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.10.freebsd-questions=freebsd.org@email-od.com X-Spamd-Result: default: False [-0.80 / 15.00]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; MX_GOOD(-0.01)[mxbh.socketlabs.com,mxbsg.socketlabs.com]; FORGED_SENDER(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; MIME_TRACE(0.00)[0:+]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.90)[-0.901,0]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-0.996,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; FORGED_SENDER_VERP_SRS(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-0.21)[ip: (-0.56), ipnet: 142.0.176.0/22(-0.25), asn: 7381(-0.18), country: US(-0.06)]; NEURAL_SPAM_SHORT(0.32)[0.317,0]; RCVD_IN_DNSWL_NONE(0.00)[198.176.0.142.list.dnswl.org : 127.0.15.0]; ENVFROM_VERP(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 21:21:06 -0000 On Sun, 14 Jul 2019 15:19:46 -0500 Valeri Galtsev wrote: > As a matter of fact, Android by no means should be considered “Linux > based”. It runs on a Linux kernel, that makes it Linux based IMHO. > (Maemo was one). Even though google used Linux kernel, but to > that they have added big chunk of proprietary code, and whoever says what > that code does will go to prison. Android is open source (Google make all the source available), however nearly every device has proprietary drivers produced by the chipset manufacturer (not Google) with source and/or specifications available only under NDA. The device manufacturer usually also adds proprietary application code. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sun Jul 14 21:41:48 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 994AFA7BB0 for ; Sun, 14 Jul 2019 21:41:48 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out1-smtp.messagingengine.com (out1-smtp.messagingengine.com [66.111.4.25]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id BE1558E57F for ; Sun, 14 Jul 2019 21:41:46 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 837BF21583 for ; Sun, 14 Jul 2019 17:41:40 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Sun, 14 Jul 2019 17:41:40 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:mime-version:content-type; s= fm3; bh=11ncoXLALbnJxVHO57mdhXqP3U2D3gLtdfo+Xfc+mJQ=; b=Elvdnb28 6/uASx1t5j4G7+RHw0Yh1IlFgAPPhn0cf9ygx8imKMWxU9ccytEZTSujKaKuX6nM kRkpLdLud02SuZdWCunQXk11HTDDfiA72cXQTCsGeWqIomyuwwv3OuFlV6gVzlhf e7soYBPALiwVGYNMdjI0akfx4XT7cCBDcrSD5+LMc2G+AvB3rHI453zZX8FOO2xV fXdcb0+yDu868xhmmAOdwUJRSeRpmmd4ELvGk7WAqlUnM4niDDTI4sFmbpb5TuLa AScSaOmFBVWDZY4+hONC4EGQXp6uoCQhYjdDTgFPCpfAk3EXmM8KZ6Ap9ttzPshY a8UdS7IRMQTVhg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-proxy:x-me-proxy:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=11ncoXLALbnJxVHO57mdhXqP3U2D3 gLtdfo+Xfc+mJQ=; b=XHh8Agcl3v1Rxn2e3WCPHpFgGOYumTkyXval2r0rif5Xk 4wJEroEUKKhw0oeXBHDcRuKs9brmNnHptLji2b0gF+7rATTMKl67nmGLAZSKuDxc BOn4m3mb+H2TEn0inl25yCsDsxdi0sMHBTX3iYuROy9XBxE02RzOXB3QxnuJgyEm MOG0bGARag4VxtunN78UeYCgaABno6BrOtaSKxhhXmUyCGcUfUQ7GRPwbLFTWw2U JG+vU8/kBx0n0uTlZs1B+/ykQmNLzM9nYQ7/9IFq2vdXvtYVatgj21sW9RA7uq23 mri3k4zW/TxXajhfvCQnZ8n8yu6Qg2MQv4YdLBQcg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrheehgdduieekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpeffhffvuffkgggtuggfsehgtderre dtredvnecuhfhrohhmpehtvggthhdqlhhishhtshcuoehtvggthhdqlhhishhtshesiiih gihsthdrnhgvtheqnecuffhomhgrihhnpehfrhgvvggsshgurdhorhhgnecukfhppeekvd drjedtrdeluddrleelnecurfgrrhgrmhepmhgrihhlfhhrohhmpehtvggthhdqlhhishht shesiiihgihsthdrnhgvthenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id A31A08005A for ; Sun, 14 Jul 2019 17:41:39 -0400 (EDT) Date: Sun, 14 Jul 2019 22:41:37 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: make installworld failure for freebsd-12R (r349986) Message-ID: <20190714214137.GA45192@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="+HP7ph2BbKc20aGI" Content-Disposition: inline User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: BE1558E57F X-Spamd-Bar: --------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=Elvdnb28; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=XHh8Agcl; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.25 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-9.14 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.25]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; MX_GOOD(-0.01)[in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com]; NEURAL_HAM_SHORT(-0.97)[-0.974,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; IP_SCORE(-3.46)[ip: (-9.47), ipnet: 66.111.4.0/24(-4.78), asn: 11403(-2.99), country: US(-0.06)]; RCVD_IN_DNSWL_LOW(-0.10)[25.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 21:41:48 -0000 --+HP7ph2BbKc20aGI Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi, I get the following error from these sources: Relative URL: ^/releng/12.0 Repository Root: https://svn.freebsd.org/base Repository UUID: ccf9f872-aa2e-dd11-9fc8-001c23d0bc1f Revision: 349986 and uuencode is present: # which uuencode /usr/bin/uuencode what can I do? it fails here: install -o root -g wheel -m 444 /usr/src/share/syscons/keymaps/us.iso.acc.kbd /usr/share/syscons/keymaps/us.iso.acc.kbd install -o root -g wheel -m 444 /usr/src/share/syscons/keymaps/us.iso.macbook.kbd /usr/share/syscons/keymaps/us.iso.macbook.kbd =3D=3D=3D> share/syscons/scrnmaps (install) installing DIRS FILESDIR install -d -m 0755 -o root -g wheel /usr/share/syscons/scrnmaps install -o root -g wheel -m 444 armscii8-2haik8.scm /usr/share/syscons/scrnmaps/armscii8-2haik8.scm =2E/iso-8859-1_to_cp437.mk iso-8859-1_to_cp437.tmp uuencode iso-8859-1_to_cp437.tmp iso-8859-1_to_cp437 > iso-8859-1_to_cp437.scm /tmp/install.pHuO1bS5/sh: uuencode: not found *** Error code 127 Stop. make[6]: stopped in /usr/src/share/syscons/scrnmaps *** Error code 1 Stop. make[5]: stopped in /usr/src/share/syscons *** Error code 1 Stop. make[4]: stopped in /usr/src/share *** Error code 1 Stop. make[3]: stopped in /usr/src *** Error code 1 Stop. make[2]: stopped in /usr/src *** Error code 1 Stop. make[1]: stopped in /usr/src *** Error code 1 Stop. make: stopped in /usr/src [...] thanks, --=20 J. --+HP7ph2BbKc20aGI Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0roYkACgkQs8o7QhFz NAXnUhAAiXsBk6pHstOfNMH8kmvvC8K+f27ANEgDm8XVAEct4TwvBQ2h3qNFiGKg EFlN8/0HAqo0FluXWw/57YACNooObtVeBSNQIe3LhErnd5xr9dphrIb59uPi7qz8 6mIUxy/ZXcrAf7C8Pia2TeYXbaJYj/V5KR1SLbere7EqxYphRBIv+EVvfF/2MA7z RAB/t5FXAdLFQ4O4QzseS3cKoDwjL8xM+R5jEFYYyv8wyWrcu4UuxXoOoiL5fme/ oACzVJNPc4UDC7GW75YgmxPBQiODdPQKyaldrwRmzim68KeRdsfjh8IBInF8MSGt NRUaYXPbEfEvlAUV8NLfBGVKKymE207sN3DW1884WkpYgOM59SfYUJ6NMkUmCXAG +jH4HIjcZysE5/MwFd1yuGkjI9QUW+WEqJgwsVYzwzgEyg1fIAC0XzIDF2eNCq3r w6lpu0Ondv63PqoUGlENDYn6dXz30jxN0n3/l9fHly4uz0TNKNyQRJ7Te2xlvOkQ Wd1/kbVKqyTv1VKUIC5WWYVG/jcG8hifNG+fb4HiPCRONeDrf1ECUgHJD39e/IeC GwY4JQuQqdVch2OzD1QxS4gsOX16DKdJ1ObF8Se34a29U+tbL0vT8xJoVQVh33gL Qnr13yksIEmp3wVXuWDsLsRUl5D8mf6+z74akTSaed06nPstJGg= =G8nD -----END PGP SIGNATURE----- --+HP7ph2BbKc20aGI-- From owner-freebsd-questions@freebsd.org Sun Jul 14 22:09:15 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 737A3A842F for ; Sun, 14 Jul 2019 22:09:15 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [217.72.192.74]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 6FAE78F2F7 for ; Sun, 14 Jul 2019 22:09:12 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.223.163.113]) by mrelayeu.kundenserver.de (mreue109 [212.227.15.183]) with ESMTPA (Nemesis) id 1MS3rB-1hsb8p1mRf-00TQe0; Mon, 15 Jul 2019 00:09:00 +0200 Date: Mon, 15 Jul 2019 00:09:00 +0200 From: Polytropon To: Manish Jain Cc: "freebsd-questions@freebsd.org" Subject: Re: How to explore Android device files under FreeBSD ? Message-Id: <20190715000900.a4ca7685.freebsd@edvax.de> In-Reply-To: References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:oQ8prE0Cc7XCsrthWCAaSxRcV9v2uERxEkxZYKFrUov1fPvM6UP g/hUgfJvyMR9M7v8WwuOlzPu4/QgYiOdTcYsn8QzmIgIQmrz8MbYJR1mg6iklME2Un2ivY4 B5NrjRRMoXiMCJQ7N+pIafksWluviacFh40AK3RWqFb3c0WrVuKCiZeP4MTfs9qt7g08/sE k7q3yJqOkoUpvYyArLVxg== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:B2trKkVAJKE=:3LUk3kOSA1vzEhmnRbLppo q8JFNcYW2as6BPdR8Qnm+kK+KdTivsPyYQekAUkN5D4Du+lkYgc74U1Qrli/ib+3XJGiZB8Dm wTzscmGigva0dwZZsNvzE2MiLq+KgutK3jMST0Yv60kefH7sbfAZd9rP6sv1Tqjywj/U1mF2A 4ELoMwEAiBNgJ/2OgAOBOlyxNfcBspLqjOAxdHddEPdnqIQhqug2PyE8yfE5stc9jf1I+u0PP MJ7gDMn0bvRt7tTvKYx9Xr1ZCEeQzIZue3Tb5nxMuB8rWPpGd7xCAhVuQ0IJTa51sr68/ynWC XnUHpqd0LlhPl9LjDUu5GEJl774D+Uch1IoTJkvmrQEG8mQMBdUABwq6nEdkFXjecmol1imjq XYAhKoUBZdrHGAbT3gGp0hXAf9HpNXJoGmeamgW293R5winIyr+8HBuOvHa3Z1hNQAknFRZO3 g/eZU5I5ybd7s6kmAcdznIyV9IBUOoyOU2AjKOVt4JztwW62dJ5K9Ivftebndmb8yUz1M5QEC aRwKo/kbaDCfssI9rmuXImKbK0H1wx2paHCoJHTcaVfbNe3FOJBc/vIx39dVDt4KTLc84us7u t6FCgzGIMtABQ5KavAU5MScL8wAYlUwQ44GDcBhYSVTKSgZdn/M0+T1NIs73oACZQJ5E3kAy1 FuXoYHJTRmPgTVXjgeNdmK5tAQbBU1NRljkM/UBjsNUGSRiZ3n51CzQbk9dSCdt9rdnp1mCS8 eEannVHFAdA6oyzwGC362EjFFdge1mZHIOSzy1Bx6NYa7U0Ewz4Gj9be47I= X-Rspamd-Queue-Id: 6FAE78F2F7 X-Spamd-Bar: ++++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [6.34 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[mx01.schlund.de,mx00.schlund.de]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[hotmail.com]; RECEIVED_SPAMHAUS_PBL(0.00)[113.163.223.94.zen.spamhaus.org : 127.0.0.11]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:217.72.192.0/20, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.96)[0.965,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.67)[0.668,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000,0]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[74.192.72.217.list.dnswl.org : 127.0.5.0]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; IP_SCORE(0.32)[ip: (-0.90), ipnet: 217.72.192.0/20(0.12), asn: 8560(2.40), country: DE(-0.01)] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 22:09:15 -0000 On Sun, 14 Jul 2019 20:58:15 +0000, Manish Jain wrote: > Nothing I have tried has worked so far. It would be helful (and valuable for further reference) if you could provide the commands you tried and their results. Have you been able to check that the phone is somehow listed in "dmesg" output when attached? Without this verification, everything else is futile. > But I am willing to spend a few > bucks to settle this once and for all (considering that FreeBSD does not > yet support Bluetooth adapters). FreeBSD does support them. If I remember correctly, one of my laptops running FreeBSD 12 has a BT device which is supported, but I don't have any BT hardware to use it... > My phone has WiFi connectivity too. So if I can get a WiFi adapter that > is supported under FreeBSD, I could perhaps transfer files via that route. If you have a "modem/router/WLAN AP" combined device that connects your PC and your phone to the Internet, just make sure they both get IP addresses in the same subnet. In this case, you should be able to connect like this: to the Internet (not needed) | +---*---+ PC-----LAN-----| box |--< ) ) ) WLAN ) ) ) phone +-------+ So you connect "through" the box, on "IP level", not directly. But that doesn't matter. As soon as your phone has an IP, you could follow the suggestion to install an "FTP server app" on it and access your files that way - provided that the files are exported via the "FTP server app", which you have to test. > Question is : is there a WiFi adapter that is supported under FreeBSD as > well as available at Amazon India (https://www.amazon.in) ? Shouldn't be needed, see idea bove. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Sun Jul 14 23:34:41 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4331EAAF02 for ; Sun, 14 Jul 2019 23:34:41 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: from mail-wm1-x32d.google.com (mail-wm1-x32d.google.com [IPv6:2a00:1450:4864:20::32d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 38DC86BF21 for ; Sun, 14 Jul 2019 23:34:40 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: by mail-wm1-x32d.google.com with SMTP id p74so13336103wme.4 for ; Sun, 14 Jul 2019 16:34:40 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=XYoQnOejF5ORZ7u8ZB03bqB+0Tw0+pTLcQ6w/ft9TVI=; b=DtPndusS8mFVZetrsiZpwzzYkZM5V8WFoJ1/B9msjwqdv7UrbnlK8thpVm3iq8889y Omk8RgGiEGsakN2XtKKCYqNYXRsKBiCLKm6nelw12YIAQ21+dlmJ06JgBb8Qpjh7lFq9 hCaaW+6iXObRWO6I6ddRKzbJ8xTYG1HUf5ZrmukQ527mb2TWqvISZzmo9JtA39AyBFDo v2vzrgGBN1QpJjRoxF1tZ/BpW7B5ARfpnG0D+kq2tvQvtFT/vxNz0kty+wIO/7ZMp4AC V0AeHeZjGi7QnKNDopxPLxrwx4STc2kgx4pH/KLNv4QvgSz+hGNfcSfksq0mVszjgzQk VrxQ== X-Gm-Message-State: APjAAAUBvFfJr0vs/keHGjRbpAp3HWnA5bl5jceXCnN4TlBmx7MJYbpl sQN3nB6nUnFRqP7W7Kuungmzs6peijI= X-Google-Smtp-Source: APXvYqz4Y67nIJBelHobj4yaShDgeVX6Gk6lRXme1rZ+DvGVywcJ56PZOIn3cCMwEGYMB02z4/0sIg== X-Received: by 2002:a7b:c144:: with SMTP id z4mr21582702wmi.50.1563147277937; Sun, 14 Jul 2019 16:34:37 -0700 (PDT) Received: from gumby.homeunix.com ([2.124.245.244]) by smtp.gmail.com with ESMTPSA id b186sm12276048wmb.3.2019.07.14.16.34.36 for (version=TLS1_3 cipher=AEAD-AES256-GCM-SHA384 bits=256/256); Sun, 14 Jul 2019 16:34:37 -0700 (PDT) Date: Mon, 15 Jul 2019 00:34:35 +0100 From: RW To: freebsd-questions@freebsd.org Subject: Re: How to explore Android device files under FreeBSD ? Message-ID: <20190715003435.49ada1a3@gumby.homeunix.com> In-Reply-To: <20190714194416.6948d301.freebsd@edvax.de> References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; amd64-portbld-freebsd12.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 38DC86BF21 X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.74 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; FREEMAIL_FROM(0.00)[googlemail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DKIM_TRACE(0.00)[googlemail.com:+]; DMARC_POLICY_ALLOW(-0.50)[googlemail.com,quarantine]; NEURAL_HAM_SHORT(-0.81)[-0.806,0]; FROM_EQ_ENVFROM(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[244.245.124.2.zen.spamhaus.org : 127.0.0.10]; SUBJECT_ENDS_QUESTION(1.00)[]; FREEMAIL_ENVFROM(0.00)[googlemail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[googlemail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[googlemail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[d.2.3.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-2.93)[ip: (-9.24), ipnet: 2a00:1450::/32(-2.90), asn: 15169(-2.44), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 23:34:41 -0000 On Sun, 14 Jul 2019 19:44:16 +0200 Polytropon wrote: > Why doesn't it seem to occur to people that this sounds entirely > wrong? It's not that it is impossible, or doesn't work - but > shouldn't it be much easier to copy _your_ photos from _your_ phone > without requiring a 3rd party app, registering for a crappy cloud > service, or mess with "developer settings"? You shouldn't need to do that. "developer settings" is probably a misunderstanding. > In my opinion, it should be as easy as attaching the USB cable and > then immediately having access to a direct access mass storage, as > per the standard. There's no good reason to support that when MTP does it better and is widely supported. > Mount it, copy your files, unmount it, done. No > need for apps and cloud nonsense. Of course, using an MTP interface > is also easy, and with GUI tools like gtkam, access is super easy. > It should work that way by default, with cable. You can do that, but some people prefer to do it wirelessly. Most Android file managers support sftp (as well as ftp and ftps), but I've never got any of them to work with FreeBSD. I get sshd[77936]: error: PAM: Authentication error for from 192.168.1.65 It's strange because FileZilla works from Windows, and I can get ssh terminal access from Android and Windows. Username and password are pure ASCII. > Why do manufacturers think it's okay to make things needlessly > complicated? In my experience they haven't. From owner-freebsd-questions@freebsd.org Sun Jul 14 23:39:42 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E1CD1AB08F for ; Sun, 14 Jul 2019 23:39:42 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 76EDA6C15C for ; Sun, 14 Jul 2019 23:39:41 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563147578; s=strato-dkim-0002; d=adminart.net; h=Message-ID:Date:Subject:To:From:X-RZG-CLASS-ID:X-RZG-AUTH:From: Subject:Sender; bh=Nj0jZraDWEzC6/RYCHHTTE1wnZq4ApKhuMoMppUAA08=; b=edHjrkdFK1PssbL11wysFlsGZCc75779UdbCvag/w6ZX5ptE6ALmrDxJ3VVN8PsxzR 3hqo/fuNz4TblogcxXro2PKoPFbsDBiKJXOfoKt6a9oQCx4VV5e998feMmMRXJqcULnK pIt071rLiMrvFS55dv2ufmT1uCTX9Vy6tRgok3+yvL9KMyJ+tBGIBf9PXtWlfxrG+zU3 ilAwwU4WRBAvISJqbi4CgEX4y89S56pO/PlpzCyRiHTxv98NvvpGFBQdedImiyyInRqQ e4lElR62M2NFMZwyaxuYvlhA0eOuLzI2znBJbMT7Adw94pEB/Y5rdge3RAm1euWy4fBz 8DSg== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6ENdcRKq (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate) for ; Mon, 15 Jul 2019 01:39:38 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmo5h-00014T-O5 for freebsd-questions@freebsd.org; Mon, 15 Jul 2019 01:39:37 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmo5h-00010Z-KY for freebsd-questions@freebsd.org; Mon, 15 Jul 2019 01:39:37 +0200 From: hw To: freebsd-questions@freebsd.org Subject: What does it mean to use ports? Date: Mon, 15 Jul 2019 01:39:21 +0200 Organization: my virtual residence Message-ID: <87o91wqjl5.fsf@toy.adminart.net> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 76EDA6C15C X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=edHjrkdF X-Spamd-Result: default: False [-2.28 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.43)[-0.433,0]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[8.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; MIME_TRACE(0.00)[0:+]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[adminart.net]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.25), asn: 6724(-0.41), country: DE(-0.01)]; R_SPF_NA(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 23:39:42 -0000 Hi, so I wanted to see what would happen if I used a port and removed the emacs-nox packages and its dependencies. Then I started installing the emacs port. What is going on here? It seems as if I need to compile the whole system myself now. Is there a way to give all the answers to the questions about compile options at the beginning? I don't have time to sit around until the next question shows up. What if I want to change the compile options? How do I make it so that all the packages asking for me for options will do so again? I don't even remember all the packages that want to be compiled. Can I globally set compile options like -march=native (or whatever the equivalent for FreeBSD is)? From owner-freebsd-questions@freebsd.org Sun Jul 14 23:39:42 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E3E35AB091 for ; Sun, 14 Jul 2019 23:39:42 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::10]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 76E5B6C15A for ; Sun, 14 Jul 2019 23:39:41 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563147579; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=CKHDzUxTuPOjI5uNyvbu1CXzGn76cYdSO8ATTdZii6g=; b=WOlWoexUkhLjL7a/UoZTdnDND+2kRxzn+A/oNoNsqnsF+w3zS0C+Z8KY2rLxBGU7zD WGZZfghTsRDTeoHc64JydPd057EnY5Qrc3cRUJ8n19PMfgdeAKMs9z2cLIZYE+WyNBPz Sw0PxgWVvg0oI4PtJVPiQsUXKIHqVzM/6JiUViA/5aZCB+EUkeQ76WNnCEmyTRjMP0+V aPimHPRHFUJs5T+D3k7X1wrzp9qkad4zQDAOowm5RQkOZORTEDr60j/4N8PLJiVsQRSr +NJevebS4MuGlTvq0lmvrurWPvTYCPXvfHjFPBOBpWK9ruWdK3ewyH3YKghwnoBtM5XS Mbqw== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6ENdcRKo (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 01:39:38 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmo5h-00014L-DK; Mon, 15 Jul 2019 01:39:37 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmo5g-00010P-TJ; Mon, 15 Jul 2019 01:39:37 +0200 From: hw To: Ruben Cc: "Kevin P. Neal" , freebsd-questions@freebsd.org, "Clay Daniels Jr." Subject: Re: dead slow update servers In-Reply-To: <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> (Ruben's message of "Sun, 14 Jul 2019 10:37:51 +0200") Date: Mon, 15 Jul 2019 00:44:52 +0200 Message-ID: <87zhlgqlqz.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 76E5B6C15A X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=WOlWoexU X-Spamd-Result: default: False [-3.67 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.82)[-0.823,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[0.1.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.74)[ipnet: 2a01:238::/32(-3.27), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 23:39:43 -0000 Ruben writes: > On 7/14/19 7:10 AM, hw wrote: >> "Kevin P. Neal" writes: > > stuff snipped > >> >> What do you do when you put FreeBSD on a server that has a hardware RAID >> controller which doesn't do JBOD? Use ZFS on the RAID? > > > I've created rock-solid setups over the years where you just create 6 > raid0 arrays and have zfs use those 6 raid0 arrays for a raidz2 zpool. > > I've created a bunch of buggy zpools that way as well, kind of depends > on the raid controller i guess. > > You can get second hand raid controllers that have been flashed with > JBOD firmware from > > https://www.ebay.nl/usr/theartofserver > > Those raidcontrollers are great for running FreeBSD and the guy posts > lots of interesting videos on youtube and is very responsive in > support requests as well. What is the point of doing this? When you have hardware RAID, just use it rather than ZFS. What about compatibility? I had to return Dell controllers because they would not run in any of the machines I put them in, and who says any of the controllers this guy sells would have no issues in, for example, a DL380? Do you change out the backplane as well, or modifiy it, in case you have somehow managed to figure out that it is giving you trouble, and/or do you adjust the firmware of the disks in case the HP firmware doesn't like the Dell or the LSI controller? Do you send controllers back and forth until you find one that seems to work, perhaps paying international shipping? > I'd always use JBOD for ZFS. That's what it is for. > If it doesn't, try to reflash or just ditch the raid-controller if it > doesn't support it (and get a "proper" one). This is ridiculous. From owner-freebsd-questions@freebsd.org Sun Jul 14 23:39:42 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E3D71AB090 for ; Sun, 14 Jul 2019 23:39:42 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p01-ob.smtp.rzone.de (mo6-p01-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5301::12]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 76E9C6C15B for ; Sun, 14 Jul 2019 23:39:41 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563147578; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=L/hOjrWwwv0GO0mWPaPyxFk/ngtCgiFS88Jdy1Z+dSE=; b=Z2FYrvHZTLsrgaATWb5hA4HTRbNupbm7TaVix6VMrTTHrMoNEdr8x3BlCdLckYh7zb WPFJtkdSiBQTg4Qd3Xt0cnC8NwvDirCVS4t40WpNgv80DRLYCTo6wx9tYoX11IL4z870 bUGZPicQsansaoDG8/sUErk/WztjI7GCThOVXQsI2AU0MjAY/eZqyGgEQ3fN2il5B11h a2bTs9xaEKlMLOIC5plxPsMP1NRjdQy5tr94zKxF0MXDWXjxe8pkA8eX1PEzD6YdyjG/ tmT7KiNDIK2We9MvkeC3n83SR3F2OVa1v6fqVpNyx41NjgbydMgMI0SD9s8x7NBRixdf dfQw== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6ENdcRKp (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 01:39:38 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmo5h-00014P-JC; Mon, 15 Jul 2019 01:39:37 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmo5h-00010U-Dr; Mon, 15 Jul 2019 01:39:37 +0200 From: hw To: Karl Denninger Cc: freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: (Karl Denninger's message of "Sun, 14 Jul 2019 07:23:10 -0500") Date: Mon, 15 Jul 2019 01:23:43 +0200 Organization: my virtual residence Message-ID: <87v9w4qjy8.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 76E9C6C15B X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=Z2FYrvHZ X-Spamd-Result: default: False [-3.27 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.42)[-0.424,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[2.1.0.0.0.0.0.0.0.0.0.0.1.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.74)[ipnet: 2a01:238::/32(-3.27), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Jul 2019 23:39:42 -0000 Karl Denninger writes: > On 7/14/2019 00:10, hw wrote: >> "Kevin P. Neal" writes: >> >>> On Sat, Jul 13, 2019 at 05:39:51AM +0200, hw wrote: >>>> ZFS is great when you have JBODs while storage performance is >>>> irrelevant. I do not have JBODs, and in almost all cases, storage >>>> performance is relevant. >>> Huh? Is a _properly_ _designed_ ZFS setup really slower? A raidz >>> setup of N drives gets you the performance of roughly 1 drive, but a >>> mirror gets you the write performance of a titch less than one drive >>> with the read performance of N drives. How does ZFS hurt performance? >> Performance is hurt when you have N disks and only get the performance >> of a single disk from them. > > There's no free lunch.=C2=A0 If you want two copies of the data (or one p= lus > parity) you must write two copies.=C2=A0 The second one doesn't magically > appear.=C2=A0 If you think it did you were conned by something that is > cheating (e.g. said it had written something when in fact it was sitting > in a DRAM chip) and, at a bad time, you're going to discover it was > cheating. > > Murphy is a SOB. I'm not sure what your point is. Even RAID5 gives you better performance than raidz because it doesn't limit you to a single disk. >> Mirroring the N disks would require another N disks, which you don't >> have. >> >> "Performance" isn't much better defined as "properly designed" here. In >> practise, I prefer a hardware RAID5 with N disks over a raidz with N >> disks and a RAID10 over a RAID5. Unfortunately, in practise, the number >> of disks is limited because they aren't cheap and because only so many >> disks can be connected to a machine without further ado while there is a >> certain requirement for storage capacity. Reality is not proper >> designed :/ >> >> >> What do you do when you put FreeBSD on a server that has a hardware RAID >> controller which doesn't do JBOD? Use ZFS on the RAID? > > Throw said controller in the trash and get a proper one. Show me, for example, such a controller that is certified to be compatible with HP DL380 gen7 servers or Dell R710s, replacing an H700+, and doesn't cost anything. > Raid controllers were very useful a decade ago when ZFS was > trouble-ridden and the controller's firmware was less-so.=C2=A0 Now it's = the > other way around. ZFS is still trouble ridden when you're using Linux even if only because it hasn't been integrated so well due to licensing issues. Software RAID has advantages and disadvantages, same as hardware RAID. In all cases I've been using RAID, hardware RAID has always been the best option considering ease of use, reliability and performance. Of all RAIDs I've been using, ZFS has shown the worst performance which was so bad that I don't want to use it anymore. Maybe ZFS works perfect with FreeBSD and has better performance than what I've seen, but being limited to the performance of a single disk remains unless you can use a mirror. > And whether you do your Raid in hardware or software Raidz is Raidz. > > I binned the last of the hardware RAID adapters in my production > machines roughly five years ago.=C2=A0 ZFS got to be faster and more-reli= able > than they were. I'd have to try ZFS with FreeBSD before I would believe that. In any case, it leaves you with the problem of connecting the disks to the machine. It's not like you could just pull the controller out and connect the disks through thin air. Fiddling with another controller until it supports JBOD (and perhaps works in that server or doesn't) isn't an option like anything else isn't that costs extra money. I don't know much about Dell servers; do they usually support JBOD out of the box? From owner-freebsd-questions@freebsd.org Mon Jul 15 00:06:09 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7DC2FABB3F for ; Mon, 15 Jul 2019 00:06:09 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.17.24]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 9FEF36D0FF for ; Mon, 15 Jul 2019 00:06:08 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.223.163.113]) by mrelayeu.kundenserver.de (mreue109 [212.227.15.183]) with ESMTPA (Nemesis) id 1MfpGR-1iNp9Q0X4T-00gKmT; Mon, 15 Jul 2019 02:05:57 +0200 Date: Mon, 15 Jul 2019 02:05:55 +0200 From: Polytropon To: RW Cc: RW via freebsd-questions Subject: Re: How to explore Android device files under FreeBSD ? Message-Id: <20190715020555.08e161eb.freebsd@edvax.de> In-Reply-To: <20190715003435.49ada1a3@gumby.homeunix.com> References: <13b9dc8e-f489-afaf-4b2c-e08277e2ecbd@gmail.com> <20190714194416.6948d301.freebsd@edvax.de> <20190715003435.49ada1a3@gumby.homeunix.com> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:f+EiNK1rU5VtfsXFrJw1R0bNhbGEA02M1ezGzgTvPL8wg6iRF3H RVXt0NJR4r+5XXApN+2BWMArcp6HDMqDAqtv3n88+H5s5jB5C2houmRFTT9CxqoDHjBoct6 XncriSsKzlLWT4boSKaLGiNoU1rKqac8L+ZDM6Zbc6UmMy2S3W0MaMrbNcp/zbmxqMevKIL NzVvWY0BTevNU8ZJS+vPA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:8R9Uqc1Mqhc=:8T5lWU+s+Jp43rcgj6tmdo A37y8F2LPoZWCCT+ERHAjjwZYgG8SdkNfk4BNbXAqZavqM+a5JuqiSiSHCK32hsXZIytTLNfm hdfzScfsBd5jhp3lsBRjDxz9sAdFaMvfcm/kOyL4i+KFo799GarJ9YRAXWRJpJcYos5UAbTCt aPoJUQ/P89LrQtDhM8P9cBO6564oJP90XgW8LxWBbozmBCHYMvBi6/ALLziJZ7E3KhT+rIPkB 3rmaSLnMLFpz8e+AoB3A/NBlTMYip7bu6hMxuVhQfcfnmfuXl+1nbUv2pSjYqPyoUz2IiJt2t JUtnUoVEGVOeZh+KJ7e72C6Fl4UQLgVCP3Q/fpWJgIrfmNdfUg3QORsV8lntsZ3dDA0lSMrNu 5dgto1RFlp1u5oub6sZJSu8QMWnLaA6qb3CXTjYVgmvDxyTDCzG9hXvoV9sCS3nrL9P+KW+nK gD2Q48SAPCm1vGkjK8+xjX5sOZ9bE6G+nhKRFKWIYfiPJXqjRYaaEVxceR4KsA75idPxw8uGc E/g8dS2+H4I+8WxQLQ9vJPTBHfwaHd9+OWfMeVcOlH9IAoy2oaEISXSPRrcKZDFqxbtCLVYhQ 9hRL02SfZVjeYj7Ho61vX8rgCZEvZX9nIWf9Ugl1WmQcTQNNQLWELsmuMXz+QUyyT4yOOJm/i qdYPu/+xTF3a2C47jliv2xF4ncgsDdFaxVZhQ5jBFiS4peKwRL2TUtoG6B6C33FxOiwswNptH Nq22NXTKVuKnja2OhJbg2xc1ZPdEmNRHYAnDwW3wKy/S2ACsrdA9uijmirI= X-Rspamd-Queue-Id: 9FEF36D0FF X-Spamd-Bar: ++++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [6.01 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; TO_DN_ALL(0.00)[]; MX_GOOD(-0.01)[cached: mx01.schlund.de]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[googlemail.com]; RECEIVED_SPAMHAUS_PBL(0.00)[113.163.223.94.zen.spamhaus.org : 127.0.0.11]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.98)[0.982,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.54)[0.542,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[0.999,0]; RCVD_IN_DNSWL_NONE(0.00)[24.17.227.212.list.dnswl.org : 127.0.5.0]; MID_CONTAINS_FROM(1.00)[]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; IP_SCORE(0.10)[ip: (-0.48), ipnet: 212.227.0.0/16(-1.43), asn: 8560(2.39), country: DE(-0.01)] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 00:06:09 -0000 On Mon, 15 Jul 2019 00:34:35 +0100, RW via freebsd-questions wrote: > On Sun, 14 Jul 2019 19:44:16 +0200 > Polytropon wrote: > > > > Why doesn't it seem to occur to people that this sounds entirely > > wrong? It's not that it is impossible, or doesn't work - but > > shouldn't it be much easier to copy _your_ photos from _your_ phone > > without requiring a 3rd party app, registering for a crappy cloud > > service, or mess with "developer settings"? > > You shouldn't need to do that. "developer settings" is probably a > misunderstanding. The term "development settings" is my (sloppy) translation of the menu item I had to check in order to be able to use the adb program; the german language version calls it "Entwicklung", which means development. > > In my opinion, it should be as easy as attaching the USB cable and > > then immediately having access to a direct access mass storage, as > > per the standard. > > There's no good reason to support that when MTP does it better and is > widely supported. I didn't say anything against MTP. In fact, that's how I got files from an iPad. There is absolutely nothing wrong with MTP, as there are convenient tools, both for CLI and GUI use. I just don't think it is good reasoning to assume that you have to install some app or register to some cloud service just to get your photos from your smarthone. Maybe those aren't that smart after all? ;-) > > Mount it, copy your files, unmount it, done. No > > need for apps and cloud nonsense. Of course, using an MTP interface > > is also easy, and with GUI tools like gtkam, access is super easy. > > It should work that way by default, with cable. > > You can do that, but some people prefer to do it wirelessly. Again, no problem if it works wirelessly in a similar easy manner. However, using a cable is the idea that says "most simple way", because that's how you did it with any previous device that didn't have wireless functionality (for example, cameras). > Most Android file managers support sftp (as well as ftp and ftps), but > I've never got any of them to work with FreeBSD. I get > > sshd[77936]: error: PAM: Authentication error for from > 192.168.1.65 > > It's strange because FileZilla works from Windows, and I can get ssh > terminal access from Android and Windows. Username and password are > pure ASCII. In that case, use Wireshark to examine the traffic. An alternative is of course FTP, which you should only use on trusted networks, because it doesn't have encryption of access credentials (which you could easily see in Wireshark). > > Why do manufacturers think it's okay to make things needlessly > > complicated? > > In my experience they haven't. You must be glad to have purchased a smartphone that does everything according to your expectations. Sadly, that doesn't seem to be the default, especially when you exit the "supported ecosystem" and want to do something with your everyday FreeBSD-based tools... -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Mon Jul 15 00:10:58 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 70640ABDDD for ; Mon, 15 Jul 2019 00:10:58 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [217.72.192.74]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id AA5706D364 for ; Mon, 15 Jul 2019 00:10:57 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.223.163.113]) by mrelayeu.kundenserver.de (mreue106 [212.227.15.183]) with ESMTPA (Nemesis) id 1M2OIy-1hlAgK1mYQ-003s95; Mon, 15 Jul 2019 02:10:54 +0200 Date: Mon, 15 Jul 2019 02:10:53 +0200 From: Polytropon To: hw Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? Message-Id: <20190715021053.2f82c84c.freebsd@edvax.de> In-Reply-To: <87o91wqjl5.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:tnjy6+P6/byq4soZdv3kCgzaP8H2mKial+gHrexfJHTvKUia8JC 4kdXedEGUpG8B32sqLnaYWFhds0PNshERypxnf2sKKDo2SicaDIelgzI7sZOdDtyjuX3Wlq zzBsNqMBbY0vKZ9hv/dmyeMY6dF7maiBitBQEX7FtpWtwulZWEZ6aIK06bwJWTWjbjrRBRk vPgPSIWtjbZ3HNwqd6RFw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:QkCiz94iCnU=:usOxuLNyrpci/YPYF9FeXm eJrbF+EZwz2obeKugIITEaHtbHQyaUfH80yrGAqocxhfkDHdU9KbM8JIu2Jku2Q01F5GF76eE sPlX41SvugX9KkneJYIE8k3594sDxq44Nt0CLk46ueyUJS5d2fs5NWXx3ShcWktWkbUPisHWp 5vRcVrkWYU2OYn1A65afMgG2P5V6ncenUxnLOkjS9WPtyBJfibudC0G9d6FtVOUWPPThY4/Ee OzIoJWg3iE6kkpeZTD6cTQzK0fb5tOm1ZOj3VC7+Jj66EEU+t2BVCgWlGl0bb+n9edgWhIhJx r/eXL5pV4IHz1SdLVmDlyc1ffja714T2oqhHZJhSERTVRlij9m/CEU36AGtABHBs3a7CAxySe UDhG/gffzOGxaSzQaZe4/xBlI4J5CWVHyiXcONHUVE9sRUwtPUOkauffotI/fxd52j5+ygnXj DmKu9CSHBNeIBnrkA1UObs7yBZ/knb81drwXB3jd3jWb1yrcjcXvgpyHzkCp5jeX7d5+85+gA k8ONN7KVn+3oV0vjnfdSHpiqOIV5bGY3T8RQp4Sh3pu1qUHpZ2V2Mh8rY7qlKTjX7Cn2y23od wIc04gjbGVsLvGyCWoM6bG7qPvZe9d5ksOLKAa8+ma0e485M7ax9PMPHbzNN8NgwCI09Gwnzl gdZoVR1MB9b9jrSLr7VTZ8ZQL3wVA3X3ePVliIvm5gWlhHy1oeRZzCzC8sB5RuymvFGRClM60 uIjpqE8NoitGVO49xPqUzWm+01osqW75xF7xieayC4YM84zsvmN9w+/N8x0= X-Rspamd-Queue-Id: AA5706D364 X-Spamd-Bar: ++++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [6.58 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[cached: mx01.schlund.de]; RCPT_COUNT_TWO(0.00)[2]; RECEIVED_SPAMHAUS_PBL(0.00)[113.163.223.94.zen.spamhaus.org : 127.0.0.11]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:217.72.192.0/20, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.99)[0.992,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.87)[0.869,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000,0]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[74.192.72.217.list.dnswl.org : 127.0.5.0]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; IP_SCORE(0.33)[ip: (-0.87), ipnet: 217.72.192.0/20(0.12), asn: 8560(2.39), country: DE(-0.01)] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 00:10:58 -0000 On Mon, 15 Jul 2019 01:39:21 +0200, hw wrote: > Hi, > > so I wanted to see what would happen if I used a port and removed the > emacs-nox packages and its dependencies. Then I started installing the > emacs port. > > What is going on here? It seems as if I need to compile the whole > system myself now. That exactly is "using a port". A port is just a description of sources, tools to use, how to use them, and where to put the results. What you're seeing is to be expected: The port you're building (and its dependencies) will be compiled from sources, unless they're already installed in the correct version. > Is there a way to give all the answers to the questions about compile > options at the beginning? I don't have time to sit around until the > next question shows up. Just use "make config-recursive" before "make" and "make install". Also see "man 7 ports". > What if I want to change the compile options? How do I make it so that > all the packages asking for me for options will do so again? I don't > even remember all the packages that want to be compiled. Remove the existing configuration ("make rmconfig-recursive"), clean ("make clean"), then start the build again. > Can I globally set compile options like -march=native (or whatever the > equivalent for FreeBSD is)? The file /etc/make.conf can be used for that. See "man 5 make.conf" for details. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Mon Jul 15 00:59:11 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DBED3ACB85 for ; Mon, 15 Jul 2019 00:59:11 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id A222F6E9AA for ; Mon, 15 Jul 2019 00:59:10 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1563152344; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=H1LyFcLb8gs31a38Rjw+WlMqGxA=; b=kz/0nKEpA6EShyOMtRQFq9nsRUYHGif2VPTrhNmX3X9r6ykm3LzA3pJTjtMdAynn 6LNLwamOmUUhLJ0mRthgcnlIUjqbvtVFXuy30HMTdyad6vVZJRSOxR3JEL97o9YF q/4c6TjEOVuZs/RJeskcpNrSPr+laifLxslkPKW5UzXKsgZ0doKOrerS9AwqUWJg 8P7pmucUx4OtBWQuSe3Z5/5p8O/4Sk75LLfhd0tddxTGQnHVikUvFS5rQYMBh5Zc 1ckb+umV4yUAPvx7aujKfUP4aBYY+wUHyeXzaAnJZaHObWqfgPxOEIkDx24YEGDO pN3BKFhdNEoPGVAiaN+MkQ==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.2 cv=R/9BIpZX c=1 sm=1 tr=0 a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=jpOVt7BSZ2e4Z31A5e1TngXxSK0=:19 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=0o9FgrsRnhwA:10 a=48faUk6PgeAA:10 a=-63cwlo8gyQ9Q84e93kA:9 a=CjuIK1q_8ugA:10 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Authentication-Results: smtp02.rcn.cmh.synacor.com header.from=roberthuff@rcn.com; sender-id=softfail Authentication-Results: smtp02.rcn.cmh.synacor.com smtp.user=roberthuff; auth=pass (PLAIN) Received: from [209.6.230.48] ([209.6.230.48:28792] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 99/76-10370-8DFCB2D5; Sun, 14 Jul 2019 20:59:04 -0400 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23851.53207.561626.837532@jerusalem.litteratus.org> Date: Sun, 14 Jul 2019 20:59:03 -0400 From: Robert Huff To: Polytropon Cc: hw , freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <20190715021053.2f82c84c.freebsd@edvax.de> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> X-Mailer: VM 8.2.0b under 26.2 (amd64-portbld-freebsd13.0) X-Rspamd-Queue-Id: A222F6E9AA X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=kz/0nKEp; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-5.87 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; IP_SCORE(-2.47)[ip: (-9.35), ipnet: 69.168.97.0/24(-2.94), asn: 36271(0.02), country: US(-0.06)]; TO_DN_SOME(0.00)[]; DWL_DNSWL_LOW(-1.00)[rcn.com.dwl.dnswl.org : 127.0.5.1]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[rcn.com:+]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; MX_GOOD(-0.01)[mx.rcn.com]; NEURAL_HAM_SHORT(-0.29)[-0.292,0]; RCVD_IN_DNSWL_LOW(-0.10)[78.97.168.69.list.dnswl.org : 127.0.5.1]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 00:59:11 -0000 Polytropon writes: > > Can I globally set compile options like -march=native (or > > whatever the equivalent for FreeBSD is)? > > The file /etc/make.conf can be used for that. See "man 5 make.conf" > for details. Verbum sapienti: be careful when you do this. The settings in make.conf are used for _every_ compilation on the system - ports ... and world ... and the kernel, I am still trying to find an exposition of the logic that prevents a "/etc/ports.conf" as a sibling to "/etc/src.conf" and make.conf. Respectfully, Robert Huff From owner-freebsd-questions@freebsd.org Mon Jul 15 03:44:04 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9634EAF1EF for ; Mon, 15 Jul 2019 03:44:04 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from corvid.alerce.com (corvid.alerce.com [206.125.171.163]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id AA270737C8 for ; Mon, 15 Jul 2019 03:44:03 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from postfix.alerce.com (76-226-160-236.lightspeed.sntcca.sbcglobal.net [76.226.160.236]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by corvid.alerce.com (Postfix) with ESMTPSA id A79ECDFE4; Sun, 14 Jul 2019 20:43:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alerce.com; s=dkim; t=1563162234; h=from:from:reply-to:reply-to:subject:subject:date:date: message-id:message-id:to:to:cc:cc:mime-version:mime-version: content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=7NFxDcN9uw6RIpZpIaA9cXB2L/WmXKzivV4brAxN0no=; b=lZWXVd3DAZEy9pcDfq3taLfOK7KRGtnqVvJG1rsvzAI8zLQFJou+JI+Y9Meq/jxBvFw3P+ iob12roXxDy3JwSHvXI4Uh5GBxE8EdDhYS1oT5wsefjwb1OuaOIO8F3zO4l34VMSMNgP6J 5BFrTab5/chRjQxFrz/L+FDSTrQUFYD+eT4dmA6j+H4jLvYciY7m9N/5IJa57gsafJMlG3 LuI2lTNCZVtUfMzs6stRf/x+jk+VFL+GrnqLc9tbm97xJ4aN/q0rdY9nE9qvPnQjgdYi8h P9+EvTZAjtwtttqnyPh/sRABRsrO5TmaZSAt7JeRij7fIIF4ow1shsLETcDpjw== Received: by postfix.alerce.com (Postfix, from userid 501) id 5CD352010078DF; Sun, 14 Jul 2019 20:43:53 -0700 (PDT) From: George Hartzell MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23851.63097.288562.464876@alice.local> Date: Sun, 14 Jul 2019 20:43:53 -0700 To: hw Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <87o91wqjl5.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> X-Mailer: VM undefined under 26.1 (x86_64-apple-darwin14.5.0) Reply-To: hartzell@alerce.com X-Rspamd-Queue-Id: AA270737C8 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=alerce.com header.s=dkim header.b=lZWXVd3D; dmarc=pass (policy=none) header.from=alerce.com; spf=pass (mx1.freebsd.org: domain of hartzell@alerce.com designates 206.125.171.163 as permitted sender) smtp.mailfrom=hartzell@alerce.com X-Spamd-Result: default: False [-3.79 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[alerce.com:s=dkim]; HAS_REPLYTO(0.00)[hartzell@alerce.com]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[alerce.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[alerce.com,none]; MX_GOOD(-0.01)[corvid.alerce.com]; IP_SCORE(-1.00)[ipnet: 206.125.168.0/21(-4.67), asn: 25795(-0.26), country: US(-0.06)]; NEURAL_HAM_SHORT(-0.78)[-0.784,0]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:25795, ipnet:206.125.168.0/21, country:US]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 03:44:04 -0000 hw writes: > Hi, > > so I wanted to see what would happen if I used a port and removed the > emacs-nox packages and its dependencies. Then I started installing the > emacs port. > > What is going on here? It seems as if I need to compile the whole > system myself now. > > Is there a way to give all the answers to the questions about compile > options at the beginning? I don't have time to sit around until the > next question shows up. > > What if I want to change the compile options? How do I make it so that > all the packages asking for me for options will do so again? I don't > even remember all the packages that want to be compiled. > > Can I globally set compile options like -march=native (or whatever the > equivalent for FreeBSD is)? You can also build your own set of packages from the ports (the official packages are official only because they're built by the official people...). There are two different bits of tooling that automate the process: - poudriere -- this is mostly oriented towards building packages repos that are used by multiple downstream systems, but I use it to maintain the set of packages for my mail server - the handbook docs are here: https://www.freebsd.org/doc/handbook/ports-poudriere.html - Digital Ocean has a nice tutorial here: https://www.digitalocean.com/community/tutorials/how-to-set-up-a-poudriere-build-system-to-create-packages-for-your-freebsd-servers - synth -- mostly oriented towards single system setups, though it can easily build shared repos. - github repo here: https://github.com/jrmarino/synth g. From owner-freebsd-questions@freebsd.org Mon Jul 15 03:47:58 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 83D5BAF302 for ; Mon, 15 Jul 2019 03:47:58 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from corvid.alerce.com (corvid.alerce.com [206.125.171.163]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 052D473978 for ; Mon, 15 Jul 2019 03:47:57 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from postfix.alerce.com (76-226-160-236.lightspeed.sntcca.sbcglobal.net [76.226.160.236]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by corvid.alerce.com (Postfix) with ESMTPSA id 83478DFF2; Sun, 14 Jul 2019 20:47:56 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alerce.com; s=dkim; t=1563162476; h=from:from:reply-to:reply-to:subject:subject:date:date: message-id:message-id:to:to:cc:cc:mime-version:mime-version: content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=DAy9+sSXNf7EZy1KovhWSaYJ1FrH3Obo7aL+WAApvaw=; b=OUsz+yqLHUUy3iaIamatH4g02zLre2T9nij4YBh45M6dY70NSbkL0BIizWiG+aeDZ7Qdyd YgMzul1N70/UWkLdkcnipa5SVIKjPiiCVyiQ7Jcbr8csbsIjAt02aN60ow3i5TJKeZ0XQo IsyCFa3M64x9UIPerZkW3WsMBFH8Y+CK+zpVs1z2FgBDn8TpswFbGOhb1+x0A8m1mo+THu 6EqjxC7yo9iqIbV8wYpYdPwcwa5j2Hg+L+0itNnFKg9NgIYc3dZ5hRMWk0SOejSFMf9EQl TG7boJYZrBjMl30Tf8vOjzpX7RuhtqYVBuivIuZh3zDy3LHECGu3pEy2Wrimmg== Received: by postfix.alerce.com (Postfix, from userid 501) id 7BB9A201007905; Sun, 14 Jul 2019 20:47:56 -0700 (PDT) From: George Hartzell MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23851.63340.445828.46420@alice.local> Date: Sun, 14 Jul 2019 20:47:56 -0700 To: hw Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <87o91wqjl5.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> X-Mailer: VM undefined under 26.1 (x86_64-apple-darwin14.5.0) Reply-To: hartzell@alerce.com X-Rspamd-Queue-Id: 052D473978 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=alerce.com header.s=dkim header.b=OUsz+yqL; dmarc=pass (policy=none) header.from=alerce.com; spf=pass (mx1.freebsd.org: domain of hartzell@alerce.com designates 206.125.171.163 as permitted sender) smtp.mailfrom=hartzell@alerce.com X-Spamd-Result: default: False [-3.75 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[alerce.com:s=dkim]; HAS_REPLYTO(0.00)[hartzell@alerce.com]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[alerce.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[alerce.com,none]; MX_GOOD(-0.01)[cached: corvid.alerce.com]; IP_SCORE(-0.99)[ipnet: 206.125.168.0/21(-4.63), asn: 25795(-0.26), country: US(-0.06)]; NEURAL_HAM_SHORT(-0.75)[-0.748,0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:25795, ipnet:206.125.168.0/21, country:US]; SUBJECT_ENDS_QUESTION(1.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 03:47:58 -0000 hw writes: > Hi, > > so I wanted to see what would happen if I used a port and removed the > emacs-nox packages and its dependencies. Then I started installing the > emacs port. > [...] Another HEADS UP: - It's safe to install your stuff from the official package repository and it's safe to install your stuff by building it all from the ports tree. - It may or may not work out if you install some stuff from the official packages repo (which was built from the ports tree as it stood 3-12 months ago) and some stuff from the current ports tree. Sometimes it works, sometimes it doesn't. Choosing one approach or the other is generally safer. The third hand (gripping hand, for you Pohl fans) is to build all of your things offline using poudriere/synth and then manage them with the pkg tools. It works best when you know what you want, and/or can be patient when you decide you want new things. g. From owner-freebsd-questions@freebsd.org Mon Jul 15 04:26:33 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A744AAFC99 for ; Mon, 15 Jul 2019 04:26:33 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p01-ob.smtp.rzone.de (mo6-p01-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5301::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 44EFF7514C for ; Mon, 15 Jul 2019 04:26:31 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563164789; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=WyfElFBvEi7+yp5TqL3Ub5UISYySE75tmw2H2ETQGpI=; b=osg3Mgi9UmKPW4vbDvBog5i9ucybeHaja2hSTi2J2pLu571WrWtFtxoWwpHgoT6t7F zIwREwZkF7NOo1CsbpwoPs6u9K/kZcsI9yNQMz84p3PlwgvA7tYHFqzauT9XnDzQOgJC 4pjS0EwYPxkJYksSeFgKrqT2icuJ8vstz+7c94htkoODwR1KH3UEs3GWWL0RF+U0bvwP kv8WhTCVhqY33ZP1sxR7/WNKdmf/8BMei0ZRO9TOJQFkBtHUL87JhyLE11lVrXCjz2Cc kRCiZlAJkLItEMde1lzV3w1hMtwNguwWCfEsI8h5Rlo4xV46os0BIz16nmlGMGwzQ9vr qxfw== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6F4QRRPL (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 06:26:27 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmsZH-0001yM-Bi; Mon, 15 Jul 2019 06:26:27 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmsZG-0000l5-SV; Mon, 15 Jul 2019 06:26:27 +0200 From: hw To: "Kevin P. Neal" Cc: Karl Denninger , freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: <20190715014129.GA62729@neutralgood.org> (Kevin P. Neal's message of "Sun, 14 Jul 2019 21:41:29 -0400") Date: Mon, 15 Jul 2019 05:42:25 +0200 Organization: my virtual residence Message-ID: <87ftn8otem.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <87v9w4qjy8.fsf@toy.adminart.net> <20190715014129.GA62729@neutralgood.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 44EFF7514C X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=osg3Mgi9 X-Spamd-Result: default: False [-3.62 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.78)[-0.783,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[9.0.0.0.0.0.0.0.0.0.0.0.1.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.25), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 04:26:33 -0000 "Kevin P. Neal" writes: > On Mon, Jul 15, 2019 at 01:23:43AM +0200, hw wrote: >> Karl Denninger writes: >>=20 >> > On 7/14/2019 00:10, hw wrote: >> >> "Kevin P. Neal" writes: >> >> >> >>> On Sat, Jul 13, 2019 at 05:39:51AM +0200, hw wrote: >> >>>> ZFS is great when you have JBODs while storage performance is >> >>>> irrelevant. I do not have JBODs, and in almost all cases, storage >> >>>> performance is relevant. >> >>> Huh? Is a _properly_ _designed_ ZFS setup really slower? A raidz >> >>> setup of N drives gets you the performance of roughly 1 drive, but a >> >>> mirror gets you the write performance of a titch less than one drive >> >>> with the read performance of N drives. How does ZFS hurt performance? >> >> Performance is hurt when you have N disks and only get the performance >> >> of a single disk from them. >> > >> > There's no free lunch.=C2=A0 If you want two copies of the data (or on= e plus >> > parity) you must write two copies.=C2=A0 The second one doesn't magica= lly >> > appear.=C2=A0 If you think it did you were conned by something that is >> > cheating (e.g. said it had written something when in fact it was sitti= ng >> > in a DRAM chip) and, at a bad time, you're going to discover it was >> > cheating. >> > >> > Murphy is a SOB. >>=20 >> I'm not sure what your point is. Even RAID5 gives you better >> performance than raidz because it doesn't limit you to a single disk. > > I don't see how this is possible. With either RAID5 or raidz enough > drives have to be written to recover the data at a minimum. And since > raidz1 uses the same number of drives as RAID5 it should have similar > performance characteristics. So read and write performance of raidz1 > should be about the same as RAID5 -- about the speed of a single disk > since the disks will be returning data roughly in parallel. Well, if you follow [1], then, in theory, with no more than 4 disks, the performance could be the same. [1]: https://blog.storagecraft.com/raid-performance/ > What have you been testing RAID5 with? Bursty loads with large amounts > of raid controller cache? Of course that's going to appear faster since > you are writing to memory and not disk in the very short term. But a > sustained amount of traffic will show raidz1 and RAID5 about the same. I have been very happy with the overall system performance after I switched from software RAID5 (mdraid) to a hardware RAID controller, using the same disks. It was like night and day difference. The cache on the controller was only 512MB. I'm suspecting that the mainboard I was using had trouble handling concurrent data transfers to multiple disks and that the CPU wasn't great at it, either. This might explain why the system was so sluggish before changing to hardware RAID. It was used as a desktop with a little bit of server stuff running, and just having it all running seemed to create sluggishness even without much actual load. Other than that, I'm seeing that ZFS is disappointingly slow (on entirely different hardware than what was used above) while hardware RAID has always been nicely fast. > Oh, and my Dell machines are old enough that I'm stuck with the hardware > RAID controller. I use ZFS and have raid0 arrays configured with single > drives in each. I _hate_ it. When a drive fails the machine reboots and > the controller hangs the boot until I drive out there and dump the card's > cache. It's just awful. That doesn't sound like a good setup. Usually, nothing reboots when a drive fails. Would it be a disadvantage to put all drives into a single RAID10 (or each half of them into one) and put ZFS on it (or them) if you want to keep ZFS? > Now Dell offers a vanilla HBA on the "same" server as an > option. *phew* That's cool. From owner-freebsd-questions@freebsd.org Mon Jul 15 04:26:32 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DBF7CAFC95 for ; Mon, 15 Jul 2019 04:26:32 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 44F447514D for ; Mon, 15 Jul 2019 04:26:31 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563164788; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=zYWdZDDlvHFfM0pEldltl9hCaZYxgIcZJT8DV3LQVcU=; b=lmxOp0tdCw5gwXC+UoPU3sc4gTUvy7ElRJ7WGFcj8u3+bPE6Q8yx8h/pkIM0KjL6bY y9N3gADApc6qrdFyOF66RyGbgkuL95o6dvNoe/Tg7s67n36i7ZsxqtjWbhQJNAJ3+0uD PHZNo9iJWXrtAzarHMZgC8KaGpTNklTDQzuIHHP1AF6SWgCUN1UsRsjX458wsXSfjjk2 wn34zMWktJg/wwxrKMCfaCTweOyDKIH+Y+JPAZMCu9qIvx8Rlj4ZV8pP1V2uWnUTeSap JOuKHaUpohRtS+KcfdBmXJzUI3iubd4AdeI5sK0eDb1wsaXLJugBmwlyb5//flZNEyY4 F9vA== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6F4QSRPN (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 06:26:28 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmsZH-0001yU-LO; Mon, 15 Jul 2019 06:26:27 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmsZH-0000lF-HY; Mon, 15 Jul 2019 06:26:27 +0200 From: hw To: Robert Huff Cc: Polytropon , freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <23851.53207.561626.837532@jerusalem.litteratus.org> (Robert Huff's message of "Sun, 14 Jul 2019 20:59:03 -0400") Date: Mon, 15 Jul 2019 06:25:17 +0200 Organization: my virtual residence Message-ID: <877e8jq5zm.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <23851.53207.561626.837532@jerusalem.litteratus.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 44F447514D X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=lmxOp0td X-Spamd-Result: default: False [-2.67 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.998,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.83)[-0.830,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[1.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 04:26:32 -0000 Robert Huff writes: > Polytropon writes: > >> > Can I globally set compile options like -march=native (or >> > whatever the equivalent for FreeBSD is)? >> >> The file /etc/make.conf can be used for that. See "man 5 make.conf" >> for details. > > Verbum sapienti: be careful when you do this. The settings in > make.conf are used for _every_ compilation on the system - ports > ... and world ... and the kernel, Thanks for the warning --- Gentoo has something like that, too. Wouldn't I want everything to be optimized for the CPU it's running on? > I am still trying to find an exposition of the logic that > prevents a "/etc/ports.conf" as a sibling to "/etc/src.conf" and > make.conf. Perhaps it's not about logic. Having multiple global compile options overriding local ones on the same machine could entirely defeat the seamlessness of ports. That's assuming that there is such a seamlessness ... From owner-freebsd-questions@freebsd.org Mon Jul 15 04:26:32 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DBAE7AFC94 for ; Mon, 15 Jul 2019 04:26:32 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 44FF67514E for ; Mon, 15 Jul 2019 04:26:31 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563164788; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=/diYaQahnpaKd5VwBWUpg8f0RwmKwanXjZn9YARmFQg=; b=jlfdhXeB+by21qmmk77MPOpxvelTAt1sYnpW4eqApEh8wRlnNcJpDVSPz/Slim0+3x 7QYKjceH/8kN0Amrz9RkZqNTO7LGVy/o1bPieAQU4hz1PfccTFKxHo6USVQYcsR3sPmG zXmrY5+1xy19jhbcOoVGt+NYMoGLqyEAMY3HtxKseaMCzgKw+SKr6zS7L/DscYBg5zqO 4p185rrG8yHi7co810fVlgL+fR1xrrRPFCiQTGMUQqeKXnu+WiPlhCDNRQkjTjMkooOC 9C4Hp/DfrDnaVyHWXFCIiAW9AIDWqbqtUXautKsl6jxiWLtkwMrIlcE5z5g6lKdNuPjv xPww== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6F4QSRPM (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 06:26:28 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hmsZH-0001yQ-Gt; Mon, 15 Jul 2019 06:26:27 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hmsZH-0000lA-Br; Mon, 15 Jul 2019 06:26:27 +0200 From: hw To: Polytropon Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <20190715021053.2f82c84c.freebsd@edvax.de> (Polytropon's message of "Mon, 15 Jul 2019 02:10:53 +0200") Date: Mon, 15 Jul 2019 05:59:16 +0200 Organization: my virtual residence Message-ID: <87blxwosmj.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 44FF67514E X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=jlfdhXeB X-Spamd-Result: default: False [-2.66 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.83)[-0.826,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[1.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 04:26:32 -0000 Polytropon writes: > On Mon, 15 Jul 2019 01:39:21 +0200, hw wrote: >> Hi, >> >> so I wanted to see what would happen if I used a port and removed the >> emacs-nox packages and its dependencies. Then I started installing the >> emacs port. >> >> What is going on here? It seems as if I need to compile the whole >> system myself now. > > That exactly is "using a port". A port is just a description > of sources, tools to use, how to use them, and where to put > the results. What you're seeing is to be expected: The port > you're building (and its dependencies) will be compiled from > sources, unless they're already installed in the correct > version. There seems to be a lot more stuff needing compilation than the dependencies of emacs-nox would suggest. Some of the dependencies are quite surprising, like I would think a -nox version wouldn't need support for JPEG2000 and not depend on things like font servers and all kinds of other stuff. At some point, the whole thing failed, and I made a bug report as the instructions said ... I could as well recompile everything so it's all optimized for the CPU it's running on. But are the defaults of the compile options the ones used to compile all the binary packages, or are they different? >> Is there a way to give all the answers to the questions about compile >> options at the beginning? I don't have time to sit around until the >> next question shows up. > > Just use "make config-recursive" before "make" and "make install". > Also see "man 7 ports". > > > >> What if I want to change the compile options? How do I make it so that >> all the packages asking for me for options will do so again? I don't >> even remember all the packages that want to be compiled. > > Remove the existing configuration ("make rmconfig-recursive"), > clean ("make clean"), then start the build again. > > > >> Can I globally set compile options like -march=native (or whatever the >> equivalent for FreeBSD is)? > > The file /etc/make.conf can be used for that. See "man 5 make.conf" > for details. Thanks a lot, I'll look into that. From owner-freebsd-questions@freebsd.org Mon Jul 15 04:54:12 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BD0AAB0553 for ; Mon, 15 Jul 2019 04:54:12 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 9E6677634E for ; Mon, 15 Jul 2019 04:54:11 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1563166452; x=1565758452; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=zAgUBfNmgWugae3NEAn+jxF9pAVYUPIwAjAJun76fFE=; b=qvcPylj6PHWydPsAiOoejiaK/AXjLiKZbDSN4pRFs0MQlarA/2QLST3YaDDSR/YvoaqG1DL6/ZH/0zJ+TjYig9gTZ/1wIFHpSbHSJpGPGOmw4biSLe8DUR0/j/TJ0BRXmVma0oY9pVQh9rTJAdqAUx853dxJjFLcWkGOSu45CGw= X-Thread-Info: NDI1MC4xMi4xYjUwMDAwMDI3YmMyM2EuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r2.sg.in.socketlabs.com (r2.sg.in.socketlabs.com [142.0.179.12]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 15 Jul 2019 00:54:02 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r2.sg.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 15 Jul 2019 00:54:02 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.91 (FreeBSD)) (envelope-from ) id 1hmszw-000ICD-H5 for freebsd-questions@freebsd.org; Mon, 15 Jul 2019 05:54:00 +0100 Date: Mon, 15 Jul 2019 05:54:00 +0100 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: dead slow update servers Message-Id: <20190715055400.8528e4ea2b4b575b8649d7b1@sohara.org> In-Reply-To: <87zhlgqlqz.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> <87zhlgqlqz.fsf@toy.adminart.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.0) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 9E6677634E X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=qvcPylj6; spf=pass (mx1.freebsd.org: domain of 4250.10.freebsd-questions=freebsd.org@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.10.freebsd-questions=freebsd.org@email-od.com X-Spamd-Result: default: False [-2.15 / 15.00]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; MX_GOOD(-0.01)[cached: mxbh.socketlabs.com]; FORGED_SENDER(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; IP_SCORE(-0.21)[ip: (-0.56), ipnet: 142.0.176.0/22(-0.25), asn: 7381(-0.18), country: US(-0.06)]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; RCVD_TLS_LAST(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.97)[-0.973,0]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-0.999,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; FORGED_SENDER_VERP_SRS(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_SPAM_SHORT(0.04)[0.039,0]; RCVD_IN_DNSWL_NONE(0.00)[198.176.0.142.list.dnswl.org : 127.0.15.0]; ENVFROM_VERP(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 04:54:12 -0000 On Mon, 15 Jul 2019 00:44:52 +0200 hw wrote: > What is the point of doing this? When you have hardware RAID, just use > it rather than ZFS. ZFS is a far better solution than hardware RAID and any other file system. The only reason for using hardware RAID is because you cannot use ZFS for some reason. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Mon Jul 15 05:08:14 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 84507B0C68 for ; Mon, 15 Jul 2019 05:08:14 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id AE9B976A5C for ; Mon, 15 Jul 2019 05:08:13 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1563167294; x=1565759294; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=b50oP51TffB9tCvEKt9wgLUuTtjqu1cril36TZj0aRY=; b=FCTBX6eYFMQeVCyKsbIkK8F+Ps6b54soQ2zIqAJnb5fVu7DSIwIkZtTZ+gOLJKQkBDdIabSBfZm9mA9k8xdR1W4CDvvhb4yLwZlY7P++T/BNohRY6hEBX6VfcYZRMmm99RX7O4SS+o+U43fo7iD3R9f3q7waX6LVYZQubNaOLN0= X-Thread-Info: NDI1MC4xMi4xYjUwMDAwMDI3YmM3NWEuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r6.us-west-2a.aws.in.socketlabs.com (r6.us-west-2a.aws.in.socketlabs.com [52.40.216.92]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 15 Jul 2019 01:08:10 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r6.us-west-2a.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 15 Jul 2019 01:08:09 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.91 (FreeBSD)) (envelope-from ) id 1hmtDb-000IL0-KX for freebsd-questions@freebsd.org; Mon, 15 Jul 2019 06:08:07 +0100 Date: Mon, 15 Jul 2019 06:08:07 +0100 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? Message-Id: <20190715060807.18d0301d925376ef3d078076@sohara.org> In-Reply-To: <877e8jq5zm.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <23851.53207.561626.837532@jerusalem.litteratus.org> <877e8jq5zm.fsf@toy.adminart.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.0) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: AE9B976A5C X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=FCTBX6eY; spf=pass (mx1.freebsd.org: domain of 4250.10.freebsd-questions=freebsd.org@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.10.freebsd-questions=freebsd.org@email-od.com X-Spamd-Result: default: False [-0.97 / 15.00]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; MX_GOOD(-0.01)[cached: mxbh.socketlabs.com]; FORGED_SENDER(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; RCVD_TLS_LAST(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.89)[-0.893,0]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.991,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; FORGED_SENDER_VERP_SRS(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-0.21)[ip: (-0.55), ipnet: 142.0.176.0/22(-0.25), asn: 7381(-0.18), country: US(-0.06)]; NEURAL_SPAM_SHORT(0.13)[0.134,0]; RCVD_IN_DNSWL_NONE(0.00)[198.176.0.142.list.dnswl.org : 127.0.15.0]; ENVFROM_VERP(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 05:08:14 -0000 On Mon, 15 Jul 2019 06:25:17 +0200 hw wrote: > Thanks for the warning --- Gentoo has something like that, too. > > Wouldn't I want everything to be optimized for the CPU it's running on? It is rarely worth the compile time (ie. the CPU time saving over the lifetime of the system is less than the CPU time to perform the compilation) to optimise to a particular CPU rather than using generic binaries for the CPU family. Of course for some CPUs and some applications there are big wins to be had, but not on average especially when most software is IO bound not CPU bound. I generally only compile a port for one of two reasons, some cannot be shipped as packages for licensing reasons and some are built with different options to the ones I want (CPU optimisation is one I've not needed but YMMV). When I do need to compile a port the first thing I do is make sure my ports tree is up to date then I use make missing to get a list of dependencies that aren't installed and use pkg to install them first so that I am only compiling the one thing I need to compile rather than all the dependencies. Finally I use pkg lock to prevent package updates overwriting my customised version. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Mon Jul 15 14:29:12 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 46178BB637 for ; Mon, 15 Jul 2019 14:29:12 +0000 (UTC) (envelope-from ik@sjmulder.nl) Received: from wout1-smtp.messagingengine.com (wout1-smtp.messagingengine.com [64.147.123.24]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 5E02A937E0 for ; Mon, 15 Jul 2019 14:29:10 +0000 (UTC) (envelope-from ik@sjmulder.nl) Received: from compute3.internal (compute3.nyi.internal [10.202.2.43]) by mailout.west.internal (Postfix) with ESMTP id 627AB6B1 for ; Mon, 15 Jul 2019 10:29:03 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute3.internal (MEProxy); Mon, 15 Jul 2019 10:29:03 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=sjmulder.nl; h= date:from:to:subject:message-id:in-reply-to:references :mime-version:content-type:content-transfer-encoding; s=fm2; bh= CUpUnibnVe03KwtpA4tcEdEa+zhMZXd4EImKpxTAh6Y=; b=3HUfzYt/EnsA9Gpr hPwDJlOBWPddJogPBPub75zvup4ttoiF7w6biPzKYeeYHL0EOPKhfNoTBvmNtyk6 6awycUODxFJCbFufjIqRZ7z51HZ4beUr23FrMra6UJNQs4o2zmOYjnnGYPGxF3p7 rLF0pEcbX0dhq8NqRHbVtU68N5hZ8wlKfwByGRrquImEe+iSqbZ4AEwO0IBDfT74 8t8T651bVIOTMqXe3iTVacePL/B5JgAXz71+/ftJmwNqkKVavlcj6KVNBgUlwVJ9 T/YIYmmStnCFqwykx8a55rjQwftRQuORRhwzifBB1MrcZ8qoaA4wUMDUureGiRup W4CXJg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:content-type :date:from:in-reply-to:message-id:mime-version:references :subject:to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender :x-sasl-enc; s=fm3; bh=CUpUnibnVe03KwtpA4tcEdEa+zhMZXd4EImKpxTAh 6Y=; b=lE/5wGY6FLV9B+WWO7f0Oa8oAZUv1Ua3lg53viGXln5J03iPHkM475HL9 Xq+MWRFnkLF/pg3krSLt7rsZEDb01k/SogPlWM5TxqWCKQp6auy96UxCZSt45OY/ QNAx77k9VDX6UBAgm9tt6gzewV8p6IFkCbqvdAgf/UKg0tATPVCmzLleMnV5Gg7l jrMntaauMffP3lypqjSr7VWd1UN7IqL4nSpaiiNOhyRLNSZIKeJklahYulSIivRu 3GLsDI0THTEDlFJN4x1xN2FX0BhMyN0SNS10dfU4wCgy/fWM93vCrLvNyKlLMBZC JDYpVrAn3zsBF3d+gOE5FVObItpyw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrheekgdejfecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfgjfhfogggtgfesthejre dtjfdtvdenucfhrhhomhepfdfuihhjmhgvnhculfdrucfouhhluggvrhdfuceoihhksehs jhhmuhhluggvrhdrnhhlqeenucfkphepudeghedruddvkedrvddvjedrudekjeenucfrrg hrrghmpehmrghilhhfrhhomhepihhksehsjhhmuhhluggvrhdrnhhlnecuvehluhhsthgv rhfuihiivgeptd X-ME-Proxy: Received: from BBLP-SMULDE.colo.betabit.nl (unknown [145.128.227.187]) by mail.messagingengine.com (Postfix) with ESMTPA id D25F3380084 for ; Mon, 15 Jul 2019 10:29:01 -0400 (EDT) Date: Mon, 15 Jul 2019 16:29:32 +0200 From: "Sijmen J. Mulder" To: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? Message-Id: <20190715162932.80cb7efd26d9e89f7fc65724@sjmulder.nl> In-Reply-To: <877e8jq5zm.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <23851.53207.561626.837532@jerusalem.litteratus.org> <877e8jq5zm.fsf@toy.adminart.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.30; i686-pc-mingw32) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 5E02A937E0 X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sjmulder.nl header.s=fm2 header.b=3HUfzYt/; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=lE/5wGY6; spf=pass (mx1.freebsd.org: domain of ik@sjmulder.nl designates 64.147.123.24 as permitted sender) smtp.mailfrom=ik@sjmulder.nl X-Spamd-Result: default: False [-5.52 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:64.147.123.24]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[sjmulder.nl:+,messagingengine.com:+]; MX_GOOD(-0.01)[in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com]; NEURAL_HAM_SHORT(-0.87)[-0.868,0]; RCVD_IN_DNSWL_LOW(-0.10)[24.123.147.64.list.dnswl.org : 127.0.5.1]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:11403, ipnet:64.147.123.0/24, country:US]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[sjmulder.nl:s=fm2,messagingengine.com:s=fm3]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[sjmulder.nl]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-3.54)[ip: (-9.80), ipnet: 64.147.123.0/24(-4.88), asn: 11403(-2.99), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 14:29:12 -0000 hw wrote: > > Verbum sapienti: be careful when you do this. The settings in > > make.conf are used for _every_ compilation on the system - ports > > ... and world ... and the kernel, > > Thanks for the warning --- Gentoo has something like that, too. Note that, having adjusted USE on Gentoo, 'emerge --newuse @world' will cause the whole tree's dependency graph to be updated and all affected packages recompiled. I don't think any of the BSD port systems have this feature. Sijmen From owner-freebsd-questions@freebsd.org Mon Jul 15 15:35:16 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B8B0BBD0DC for ; Mon, 15 Jul 2019 15:35:16 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::7]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id DD249971E8 for ; Mon, 15 Jul 2019 15:35:14 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563204912; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=7b1Mnvy+4zT7z72otLcTUDL7nz4v9+5yAs9/fILY+xI=; b=K/x/j9KMtZl+9+xiAqhinrdcKiPA/c4L/32t5dH+Nc/zZLGUdQpk4Q1QRsIVY/Oqej bUW4io0lRp6yFQ4ukuFEJIOVVjLW3EDoAFH481Moj81ID0deqpu3/efXuoA3gyDXyBBt syznRUh9JiHVdsoeKe9Xa6U8eL10AJFvrjh/4gr4GQj87f23ahW4p+gxst5oxhl2LAGz UKHMChMoNEQFnSbOln5/RQ/IubX8wl40/CYg4/0paAy9SDubrz7ZNEbc/2NgDF3U0z5O fd8Ot39yBDGTrSDqqo20G/yK+oJ3vdM2i86d3WaLNAqGM3GvgFwgXWv5qwieXASgji1n VKKg== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6FFZCVIu (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 17:35:12 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hn30R-0001bF-Lp; Mon, 15 Jul 2019 17:35:11 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hn30R-00014b-HI; Mon, 15 Jul 2019 17:35:11 +0200 From: hw To: Steve O'Hara-Smith Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <20190715060807.18d0301d925376ef3d078076@sohara.org> (Steve O'Hara-Smith's message of "Mon, 15 Jul 2019 06:08:07 +0100") Date: Mon, 15 Jul 2019 17:15:44 +0200 Organization: my virtual residence Message-ID: <87wogjjplr.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <23851.53207.561626.837532@jerusalem.litteratus.org> <877e8jq5zm.fsf@toy.adminart.net> <20190715060807.18d0301d925376ef3d078076@sohara.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: DD249971E8 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=K/x/j9KM X-Spamd-Result: default: False [-2.66 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.82)[-0.821,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[7.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 15:35:16 -0000 Steve O'Hara-Smith writes: > On Mon, 15 Jul 2019 06:25:17 +0200 > hw wrote: > >> Thanks for the warning --- Gentoo has something like that, too. >> >> Wouldn't I want everything to be optimized for the CPU it's running on? > > It is rarely worth the compile time (ie. the CPU time saving over > the lifetime of the system is less than the CPU time to perform the > compilation) to optimise to a particular CPU rather than using generic > binaries for the CPU family. Of course for some CPUs and some applications > there are big wins to be had, but not on average especially when most > software is IO bound not CPU bound. That's probably true. I never noticed a difference with Gentoo, and even for software that takes advantage of particular CPU features, there may be no gain when this software isn't used much. It's more about wanting everything to be as good as it can be. Compiling everything optimized for the CPU it's running on might do that --- if you get all the options right. > I generally only compile a port for one of two reasons, some cannot > be shipped as packages for licensing reasons and some are built with > different options to the ones I want (CPU optimisation is one I've not > needed but YMMV). > > When I do need to compile a port the first thing I do is make sure > my ports tree is up to date then I use make missing to get a list of > dependencies that aren't installed and use pkg to install them first so > that I am only compiling the one thing I need to compile rather than all > the dependencies. Finally I use pkg lock to prevent package updates > overwriting my customised version. Perhaps that is the intended usage. I'll take that as a recommendation. From owner-freebsd-questions@freebsd.org Mon Jul 15 15:35:16 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B8FB3BD0DD for ; Mon, 15 Jul 2019 15:35:16 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::7]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id DD1F3971E7 for ; Mon, 15 Jul 2019 15:35:14 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563204912; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=jtI1YW/3TlbyYmSHWfIduxekWjHQxAXIQldJndIkwLI=; b=GKv5IZg/Vfyq1QuxeKhrg5gGvgi3I8ZvSN/C1HrFEsup7lVpyYX8dL+zCBj5xSJQLA JhUnmUQz/XmghUCMXdmoMfLLGud7/zfGpqqGUpRKdMFRAlWlZk9F6nFw6s7ydA20mNEe 2qGiUasPVpgvYcB0Lc2mJQbaTosu3nhNOBDDaanUSgujLIJ09Oz2CnoXfc/Gs2QLsm4R DlKzvFH7IvzPe9y5zO5ODgV1Uvpk+mmXY1ZyJcFF7eE6P8XCc+Nm59iEKhRvimDNjKYn suCR7wVUyBHahiU4MkH5mBu4WoNTBVDJPx1YVyBOARdoO6Vy7A02d+/+nfuH4+GQ+Iem 4Ocw== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6FFZCVIv (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 17:35:12 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hn30R-0001bJ-R5; Mon, 15 Jul 2019 17:35:11 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hn30R-00014g-MX; Mon, 15 Jul 2019 17:35:11 +0200 From: hw To: George Hartzell Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <23851.63340.445828.46420@alice.local> (George Hartzell's message of "Sun, 14 Jul 2019 20:47:56 -0700") Date: Mon, 15 Jul 2019 17:34:40 +0200 Organization: my virtual residence Message-ID: <87sgr7joq7.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <23851.63340.445828.46420@alice.local> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: DD1F3971E7 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=GKv5IZg/ X-Spamd-Result: default: False [-2.66 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.82)[-0.825,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[7.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 15:35:16 -0000 George Hartzell writes: > hw writes: > > Hi, > > > > so I wanted to see what would happen if I used a port and removed the > > emacs-nox packages and its dependencies. Then I started installing the > > emacs port. > > [...] > > Another HEADS UP: > > - It's safe to install your stuff from the official package repository > and it's safe to install your stuff by building it all from the > ports tree. > > - It may or may not work out if you install some stuff from the > official packages repo (which was built from the ports tree as it > stood 3-12 months ago) and some stuff from the current ports tree. > Sometimes it works, sometimes it doesn't. > > Choosing one approach or the other is generally safer. > > The third hand (gripping hand, for you Pohl fans) is to build all of > your things offline using poudriere/synth and then manage them with > the pkg tools. It works best when you know what you want, and/or can > be patient when you decide you want new things. Thanks! Somehow I thought this would be a lot easier --- and of course, it isn't. For now, I'll stick with the binary packages until there's good reason not to. Anything else is too time consuming because there is so much that I need to figure out first. From owner-freebsd-questions@freebsd.org Mon Jul 15 15:35:16 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 931E2BD0DA for ; Mon, 15 Jul 2019 15:35:16 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::2]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id DD1C0971E6 for ; Mon, 15 Jul 2019 15:35:14 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563204912; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=CKB2bNDkxtApZHlyH4fGHXfJ64C2POTV9tb2ML7gJbI=; b=AgmPbkNl7PTYTPmB/dgTvcTu71XUZuAx/T0J7kLDsKDrs1mmdpUjxvKOcaB+dzlaVh V0obBU/Fk3Mg8Rg0C6oCvEGjLU1Qa1eFqh8BzM795i43NbFuN1kjke9kqbid5XwhJHP4 HFWvz6LFitaphtlHlelEsEbviPDIbyrZBqa8MjywYUEJIusIlCo13ZE58cUuZ0tz93TQ 2dWDU61QERu/ebnUC3A605xNTrE6Rvm4Oz3AEaUqaDRPM2dF5JaQquxw+nuzA8soEihW KH3G2iCobKy/JF+dEebJAFuI//7MN9N0OEMa2q2qObU3kPA69NE8+7azLlgQ0eVoNMoc 0Plg== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6FFZCVIt (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 17:35:12 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hn30R-0001bB-Hr; Mon, 15 Jul 2019 17:35:11 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hn30R-00014W-2O; Mon, 15 Jul 2019 17:35:11 +0200 From: hw To: Steve O'Hara-Smith Cc: freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: <20190715055400.8528e4ea2b4b575b8649d7b1@sohara.org> (Steve O'Hara-Smith's message of "Mon, 15 Jul 2019 05:54:00 +0100") Date: Mon, 15 Jul 2019 17:00:16 +0200 Organization: my virtual residence Message-ID: <871ryrl4vz.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> <87zhlgqlqz.fsf@toy.adminart.net> <20190715055400.8528e4ea2b4b575b8649d7b1@sohara.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: DD1C0971E6 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=AgmPbkNl X-Spamd-Result: default: False [-3.66 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.82)[-0.819,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[2.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.25), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 15:35:16 -0000 Steve O'Hara-Smith writes: > On Mon, 15 Jul 2019 00:44:52 +0200 > hw wrote: > >> What is the point of doing this? When you have hardware RAID, just use >> it rather than ZFS. > > ZFS is a far better solution than hardware RAID and any other > file system. The only reason for using hardware RAID is because you cannot > use ZFS for some reason. It's more like the only reason not to use hardware RAID is when you don't have it. ZFS is just another file system with its advantages and disadvantages. That doesn't make it generally the best solution. When you use Linux or any other system it doesn't integrate well with, it's even one of your worst options. When you run FreeBSD as a VM using a file on the host as storage, ZFS may be your worst solution because it involves some unnecessary overhead. You could even say ZFS is generally the worst solution because it is incompatible with common hard- and software. Nonetheless, under the right circumstances, ZFS can still be the best solution. And why aren't there any hardware ZFS controllers? From owner-freebsd-questions@freebsd.org Mon Jul 15 15:47:52 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2EA66BD758 for ; Mon, 15 Jul 2019 15:47:52 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from corvid.alerce.com (corvid.alerce.com [206.125.171.163]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 228EB97EC5 for ; Mon, 15 Jul 2019 15:47:50 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from postfix.alerce.com (76-226-160-236.lightspeed.sntcca.sbcglobal.net [76.226.160.236]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by corvid.alerce.com (Postfix) with ESMTPSA id 06DEDE981; Mon, 15 Jul 2019 08:47:48 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alerce.com; s=dkim; t=1563205668; h=from:from:reply-to:reply-to:subject:subject:date:date: message-id:message-id:to:to:cc:cc:mime-version:mime-version: content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=r0TcJc5JPTGRqgNgnrXk3aO9FIbbAXZLI6+O3IL3nT0=; b=aUUDbQHcdq5+K2IMdsGRnb8T5oQswQ2gPqmpbl1ew90J5IiMDghzg4rIJD3lnUwJ1Hpz9D B/L8cKsjQfzFXGf/WO4xCipQGpdGalhpIOEDk5Czog/R482UNzsop9r9proEOPcbjl+Ii1 1w+56MKCw8tmptNYMMjqCp5LHnCYQUtmmlTO4AZMsG2akz96MBvXrMLngWPIdM3oFMVnis LU8Y/aGcngEcCloJ3ULiIULxVVZcMREXKX09ObPn3pbn5s0dKrBpHe/WNnNc3lbRSF30n1 g1ly/gMWCMbIhlc68bfEjWyekU5E6iQdxS/ZHDJ9VZv+7zx0feYMOSNvWU+GbQ== Received: by postfix.alerce.com (Postfix, from userid 501) id D52332010096E4; Mon, 15 Jul 2019 08:47:47 -0700 (PDT) From: George Hartzell MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23852.40995.806812.743506@alice.local> Date: Mon, 15 Jul 2019 08:47:47 -0700 To: hw Cc: George Hartzell , freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <87sgr7joq7.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <23851.63340.445828.46420@alice.local> <87sgr7joq7.fsf@toy.adminart.net> X-Mailer: VM undefined under 26.1 (x86_64-apple-darwin14.5.0) Reply-To: hartzell@alerce.com X-Rspamd-Queue-Id: 228EB97EC5 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=alerce.com header.s=dkim header.b=aUUDbQHc; dmarc=pass (policy=none) header.from=alerce.com; spf=pass (mx1.freebsd.org: domain of hartzell@alerce.com designates 206.125.171.163 as permitted sender) smtp.mailfrom=hartzell@alerce.com X-Spamd-Result: default: False [-3.94 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[alerce.com:s=dkim]; HAS_REPLYTO(0.00)[hartzell@alerce.com]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; TO_DN_SOME(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: corvid.alerce.com]; DKIM_TRACE(0.00)[alerce.com:+]; DMARC_POLICY_ALLOW(-0.50)[alerce.com,none]; NEURAL_HAM_SHORT(-0.95)[-0.950,0]; IP_SCORE(-0.98)[ipnet: 206.125.168.0/21(-4.58), asn: 25795(-0.26), country: US(-0.06)]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:25795, ipnet:206.125.168.0/21, country:US]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 15:47:52 -0000 hw writes: > [...] > Thanks! Somehow I thought this would be a lot easier --- and of course, > it isn't. For now, I'll stick with the binary packages until there's > good reason not to. Anything else is too time consuming because there > is so much that I need to figure out first. You're welcome. It's not *that* hard (once you uncover the correct magic) but there's a fair bit of complexity to juggle. Most of it's inherent complexity (unavoidable) that comes along with "building things from the internet" and/but some of it is specific to the FreeBSD way/history. It's a good thing to practice on a disposable machine (or in a jail, or ...) before you use it on anything serious. g. From owner-freebsd-questions@freebsd.org Mon Jul 15 16:16:05 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BE986BE317 for ; Mon, 15 Jul 2019 16:16:05 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 26E8D6A731 for ; Mon, 15 Jul 2019 16:16:04 +0000 (UTC) (envelope-from 4250.10.freebsd-questions=freebsd.org@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1563207364; x=1565799364; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=6LOXB75FZeUhcz5r0Yc+rfUWqPajldm8Ad3YulIpvmQ=; b=vA0ShJRXu2pZQdwO71HfSOPnnYl2XGAIiZU7iiBMks3G5iWUua0Q6px75N0qb+gQH2/lXDjrEc8dm/ZN++qg3uv7tNbXk2FyzEhKekDKQxj3yAUBJZQyKKKPo3E6AD1iPPyIH7fuqldBTWXgDZkyEukEmi4NEQC35dsPpJvSHaM= X-Thread-Info: NDI1MC4xMi4xYjUwMDAwMDI4YjU1OGMuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.sg.in.socketlabs.com (r3.sg.in.socketlabs.com [142.0.179.13]) by mxsg2.email-od.com with ESMTP; Mon, 15 Jul 2019 12:15:53 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.sg.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 15 Jul 2019 12:15:52 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.91 (FreeBSD)) (envelope-from ) id 1hn3dn-000LDt-GP for freebsd-questions@freebsd.org; Mon, 15 Jul 2019 17:15:51 +0100 Date: Mon, 15 Jul 2019 17:15:51 +0100 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: dead slow update servers Message-Id: <20190715171551.4398e18aae6b91e2ee01333c@sohara.org> In-Reply-To: <871ryrl4vz.fsf@toy.adminart.net> References: <87sgrbi3qg.fsf@toy.adminart.net> <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <0ed2aef9-0cb8-b7ab-711e-34f139c60285@osfux.nl> <87zhlgqlqz.fsf@toy.adminart.net> <20190715055400.8528e4ea2b4b575b8649d7b1@sohara.org> <871ryrl4vz.fsf@toy.adminart.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 26E8D6A731 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=vA0ShJRX; spf=pass (mx1.freebsd.org: domain of 4250.10.freebsd-questions=freebsd.org@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.10.freebsd-questions=freebsd.org@email-od.com X-Spamd-Result: default: False [-3.16 / 15.00]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; MX_GOOD(-0.01)[cached: mxbh.socketlabs.com]; NEURAL_HAM_SHORT(-0.95)[-0.947,0]; FORGED_SENDER(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; IP_SCORE(-0.21)[ip: (-0.55), ipnet: 142.0.176.0/22(-0.25), asn: 7381(-0.18), country: US(-0.06)]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; RCVD_TLS_LAST(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.10.freebsd-questions=freebsd.org@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.992,0]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; FORGED_SENDER_VERP_SRS(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_IN_DNSWL_NONE(0.00)[198.176.0.142.list.dnswl.org : 127.0.15.0]; ENVFROM_VERP(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 16:16:05 -0000 On Mon, 15 Jul 2019 17:00:16 +0200 hw wrote: > Steve O'Hara-Smith writes: > > > On Mon, 15 Jul 2019 00:44:52 +0200 > > hw wrote: > > > >> What is the point of doing this? When you have hardware RAID, just use > >> it rather than ZFS. > > > > ZFS is a far better solution than hardware RAID and any other > > file system. The only reason for using hardware RAID is because you > > cannot use ZFS for some reason. > > It's more like the only reason not to use hardware RAID is when you > don't have it. Nope, I have hardware RAID available I leave it disabled and run ZFS on drives as JBOD. > ZFS is just another file system with its advantages and disadvantages. > That doesn't make it generally the best solution. ZFS is a file system with an *integrated* redundancy layer, the coupling between the two has benefits than cannot be matched by separate RAID and filesystem. > You could even say ZFS is generally the worst solution because it is > incompatible with common hard- and software. Nonetheless, under the > right circumstances, ZFS can still be the best solution. And why aren't > there any hardware ZFS controllers? We call them file servers or NAS boxes depending on which decade we learned our terminology. -- Steve O'Hara-Smith | Directable Mirror Arrays C:\>WIN | A better way to focus the sun The computer obeys and wins. | licences available see You lose and Bill collects. | http://www.sohara.org/ From owner-freebsd-questions@freebsd.org Mon Jul 15 16:43:25 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A4680BEA4E for ; Mon, 15 Jul 2019 16:43:25 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 125816B69B for ; Mon, 15 Jul 2019 16:43:22 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563209000; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=eRHQIu0bidAe4e01ZzkrheKG8/RkslI9FP43tPH6RuE=; b=aA76MygczoIUbSVp95nfJFi9tDet4TgEbmJ1zcNBbjne4ueXR4HGHdwkcMsKR1FAxt Zn/uZlQ6Ygd2FlW1KlK+pxEDXskUcxkyonfs0fHLF1YWkJLMEzjo6QHFlZN3wTQRtDDz HpAR7tteyXJ4U4jRTH2hmXiaD/8Pby5I8LqcxUROQKluR30wDOlVxY3r0jeQoA+5Z2CE musV3SD47OnvV3NN1Oo6cPYMyQJOD3t4ddPhhY2Qc7R2vMa7gH1anT0UDnJNzrZKOvhE 4Sc7AXVVyLyv2tnaHrhYltp9TMTVpTYWdqSMnZguxOBNFZKlIO3w7CdMBdeNmFyiEE0C ZGBg== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6FGhJVU7 (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Mon, 15 Jul 2019 18:43:19 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hn44M-0001mR-Oq; Mon, 15 Jul 2019 18:43:18 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hn44M-0001nX-LE; Mon, 15 Jul 2019 18:43:18 +0200 From: hw To: "Kevin P. Neal" Cc: Karl Denninger , freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: <20190715151621.GB31450@neutralgood.org> (Kevin P. Neal's message of "Mon, 15 Jul 2019 11:16:21 -0400") Date: Mon, 15 Jul 2019 18:09:25 +0200 Message-ID: <87blxvjn4a.fsf@toy.adminart.net> References: <20190712171910.GA25091@neutralgood.org> <871ryuj3ex.fsf@toy.adminart.net> <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <87v9w4qjy8.fsf@toy.adminart.net> <20190715014129.GA62729@neutralgood.org> <87ftn8otem.fsf@toy.adminart.net> <20190715151621.GB31450@neutralgood.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 125816B69B X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=aA76Mygc X-Spamd-Result: default: False [-3.78 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.94)[-0.938,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[1.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 16:43:25 -0000 "Kevin P. Neal" writes: > On Mon, Jul 15, 2019 at 05:42:25AM +0200, hw wrote: >> "Kevin P. Neal" writes: >> > Oh, and my Dell machines are old enough that I'm stuck with the hardware >> > RAID controller. I use ZFS and have raid0 arrays configured with single >> > drives in each. I _hate_ it. When a drive fails the machine reboots and >> > the controller hangs the boot until I drive out there and dump the card's >> > cache. It's just awful. >> >> That doesn't sound like a good setup. Usually, nothing reboots when a >> drive fails. >> >> Would it be a disadvantage to put all drives into a single RAID10 (or >> each half of them into one) and put ZFS on it (or them) if you want to >> keep ZFS? > > Well, it still leaves me with the overhead of dealing with creating arrays > in the hardware. Didn't you need to create the RAID0s having a single disk, too? > And it costs me loss of the scrubbing/verification of the end-to-end > checksumming. So I'm less safe there with no less work. If you're worried about the controller giving results that lead to the correct check sums and data ending up on the disk not matching these check sums when the controller reads it later, what difference does it make which kind of RAID you use? You can always run a scrub to verify the check sums, and if errors are being found, you may need to replace the controller. > It would probably eliminate the reboots, though. But that's only if my > theory about the reboots is correct. > > The failures I've seen involve the circuit board on the drive failing and > the drive not responding to any commands ever again. My guess is that the > ZFS watchdog timer is rebooting because commands don't complete within > the timeout period. I could change that by changing the setting that keeps > ZFS from writing to a drive when a drive vanishes, but then I lose the > safety of pausing the system when a drive pops out of the slot. Yes, that > has happened before. Do the drives pop back into the slots all by themselves before the timeout expires? When a drive becomes unresponsive, ZFS should just fail it and continue to work with the remaining ones. I've seen it doing that. > Maybe I should just go ahead and change it. I've got a drive about to > fail on me. It's a three way mirror so I'm not worried about it. It would > be, uh, _nice_ if it didn't bring down the machine, though. If you were using two or more disks each in a RAID1 or RAID10 to create one disk exposed to ZFS, you wouldn't have a problem when one disk becomes unresponsive. If there's someone around who is used to quickly popping the disks back into their slots, that someone could as well replace a failed disk by simply taking it out and plugging a new one in. Hardware RAID does have advantages, so why not use them when you're stuck with it anyway? From owner-freebsd-questions@freebsd.org Mon Jul 15 18:29:54 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7D47EC0BF6 for ; Mon, 15 Jul 2019 18:29:54 +0000 (UTC) (envelope-from ktullavik@gmail.com) Received: from mail-lj1-x22c.google.com (mail-lj1-x22c.google.com [IPv6:2a00:1450:4864:20::22c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 860C67077F for ; Mon, 15 Jul 2019 18:29:53 +0000 (UTC) (envelope-from ktullavik@gmail.com) Received: by mail-lj1-x22c.google.com with SMTP id i21so17279698ljj.3 for ; Mon, 15 Jul 2019 11:29:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=9tD1Du2aubS+VI7PbY5NOpQpRT6Su3laG+uOx84urUQ=; b=Pno9RkMq7ixImLr7PmBKiDBk5R9GZmTRCuME94UuBZVoUglaMWSPgprdB5uPCjEJ1P MyqwXPKGaSHp3UrLvPlIoNs7rhmacFm3gIsAWsiqs7aG/edj3VQC9tTEOb3h6xRwqFid q+Y0Q1tyDtDkQ7yCnDvUb5Qb9fjuZA+mQmtlUSVvkWrC/FnsHMPXe9yqnwNlD0hSuOAo qcIV7wGO+zJ31zupKyCx2+gBiJs8HO8iNERFP5D/4dkUxoS78G1XmOIzqK7fmkzq3bbn iZLR2eQY83ugsPqw4LzxNPHgdtMp1P3HJsPrJMEOBCe9jfRvV2VXB9Wx05TjS/82JIgU wpcw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=9tD1Du2aubS+VI7PbY5NOpQpRT6Su3laG+uOx84urUQ=; b=CxlnMfygr9JMzGUk9XLIsiB/NDWMkeEeIBRU784AnUuvknnEIQ6UCAc+ipcuAFtRGJ Sld4KZbdbyBCPsZ8ym6PNQgKU+5InGWtnya+TWuKZyDtgSENtZFw0RUuVtndZbpz0Grp nqas6VKWmPyjo+h1UvEV1hA/YPiKfWvXgIxcvOppmuJWu92dd+iwLAiJWeCaXl1/+kJ7 1Euzyn6LJ7VF2MjuHyxA0gzrPPrs+PsCQBA0l2zAt1OI+s2MKNRcJBd11LP8nsqKIxqL dZZQHxE+sz/ddk9X6IP+uou+C3jtvwIvd50lCKo/fgk3XCLzbvGXthPlUKARfObSd9re KRfA== X-Gm-Message-State: APjAAAX+h3lLM95iPgtP+H5KesXUGLpB2HJFNK9yoTFnsx7O6VR58r9G TrYBAYfMLE8XaqhWqFccCmpl58HH X-Google-Smtp-Source: APXvYqwCCMSoR7IA3B73OUe2FcoSWnCHx/eE9EBNFGFUlP9v07aCqBT062tlEO1u9BjwLNyVZlCYkQ== X-Received: by 2002:a2e:8455:: with SMTP id u21mr14376441ljh.20.1563215391503; Mon, 15 Jul 2019 11:29:51 -0700 (PDT) Received: from ?IPv6:2001:4641:d74c:0:2da2:75c7:8440:1aeb? ([2001:4641:d74c:0:2da2:75c7:8440:1aeb]) by smtp.gmail.com with ESMTPSA id m21sm3240985ljj.48.2019.07.15.11.29.50 (version=TLS1_2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Mon, 15 Jul 2019 11:29:50 -0700 (PDT) Subject: Re: Need help to confirm hardware viability To: Manish Jain , "freebsd-questions@freebsd.org" References: From: Kjell Tore Ullavik Message-ID: <3cf03a51-f7ba-379a-48a0-cddf159d6d12@gmail.com> Date: Mon, 15 Jul 2019 20:29:50 +0200 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.7.2 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-US X-Rspamd-Queue-Id: 860C67077F X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=Pno9RkMq; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of ktullavik@gmail.com designates 2a00:1450:4864:20::22c as permitted sender) smtp.mailfrom=ktullavik@gmail.com X-Spamd-Result: default: False [-6.74 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; FREEMAIL_TO(0.00)[hotmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_SHORT(-0.73)[-0.735,0]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[c.2.2.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-2.99)[ip: (-9.57), ipnet: 2a00:1450::/32(-2.91), asn: 15169(-2.44), country: US(-0.06)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 18:29:54 -0000 On 02.07.2019 19.58, Manish Jain wrote: > Hi, > > > My PC's hardware is beginning to fail, and I shall have to build a new > box in the coming days. > > I need help from the list to confirm whether the following components > work well with FreeBSD 12 : > > > 1) AMD Ryzen 3 1200 Desktop Processor with Wraith Stealth Cooler > (YD1200BBAEBOX) > > 2) Gigabyte GA-A320M-HD2 AM4 AMD A320 HDMI USB 3.1 Type-A ATX DDR4 > Motherboard > > 2) Gigabyte (nVidia) GeForce GV-N710D3-2GL 2GB PCI-Express Graphics Card > > > Any help would be greatly appreciated. > > Been a happy user of nvidia and their closed source driver for a long time. Only problem is the occasional incompatibilty with CURRENT. But, buying a graphics card now, I'd try to get the opinion of someone familiar with the ongoing fbsd graphics work on whether AMD is a better choice. From owner-freebsd-questions@freebsd.org Mon Jul 15 18:51:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E9EE7C1022 for ; Mon, 15 Jul 2019 18:51:08 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from corvid.alerce.com (corvid.alerce.com [206.125.171.163]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 08B0F71407 for ; Mon, 15 Jul 2019 18:51:06 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from postfix.alerce.com (76-226-160-236.lightspeed.sntcca.sbcglobal.net [76.226.160.236]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by corvid.alerce.com (Postfix) with ESMTPSA id 87209EDC7; Mon, 15 Jul 2019 11:51:03 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alerce.com; s=dkim; t=1563216663; h=from:from:reply-to:reply-to:subject:subject:date:date: message-id:message-id:to:to:cc:cc:mime-version:mime-version: content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=LMo1I/HL+4YWZCWBHIGC//ahLpzaKneKGUUOE97Iwpg=; b=CYzSQDbUjeKFzM6nU8D8abzQK5mbNymBwrM8DTUjjUg87WyrfwTS/0daRcpbCdQrG8Axv5 kJmSXWy03r5S+DRusqgkkxn3IdVMJgiYQv8Jge/yxmm55JeHNC7pKH+QEgwMaixFcIbt+S cBTe3olSIahkf2dszvt/dUqzR0piX3x/6UrbW4HpDHXSB4Zk/h6WQVIU/lw9cdPPfovTXW 5ZR6+zx61Ec0fqPiMtBH6M1whxI9qLtwJiS+83nVOtobWbjkbxTIlXdFUb4EZY0+DScSsj 3ND7zgspEdDvunRMuthuTDCF5UPKIzYdhJE1WZg0MN1ytFSF0leEDYiIlWYz/Q== Received: by postfix.alerce.com (Postfix, from userid 501) id 6A4CD20100EBEB; Mon, 15 Jul 2019 11:51:03 -0700 (PDT) From: George Hartzell MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23852.51991.375594.393721@alice.local> Date: Mon, 15 Jul 2019 11:51:03 -0700 To: "Sijmen J. Mulder" Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? In-Reply-To: <20190715162932.80cb7efd26d9e89f7fc65724@sjmulder.nl> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <23851.53207.561626.837532@jerusalem.litteratus.org> <877e8jq5zm.fsf@toy.adminart.net> <20190715162932.80cb7efd26d9e89f7fc65724@sjmulder.nl> X-Mailer: VM undefined under 26.1 (x86_64-apple-darwin14.5.0) Reply-To: hartzell@alerce.com X-Rspamd-Queue-Id: 08B0F71407 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=alerce.com header.s=dkim header.b=CYzSQDbU; dmarc=pass (policy=none) header.from=alerce.com; spf=pass (mx1.freebsd.org: domain of hartzell@alerce.com designates 206.125.171.163 as permitted sender) smtp.mailfrom=hartzell@alerce.com X-Spamd-Result: default: False [-3.70 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[alerce.com:s=dkim]; HAS_REPLYTO(0.00)[hartzell@alerce.com]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: corvid.alerce.com]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[alerce.com,none]; DKIM_TRACE(0.00)[alerce.com:+]; IP_SCORE(-0.97)[ipnet: 206.125.168.0/21(-4.53), asn: 25795(-0.26), country: US(-0.06)]; NEURAL_HAM_SHORT(-0.72)[-0.720,0]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:25795, ipnet:206.125.168.0/21, country:US]; RCVD_TLS_LAST(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 18:51:09 -0000 Sijmen J. Mulder writes: > hw wrote: > > > Verbum sapienti: be careful when you do this. The settings in > > > make.conf are used for _every_ compilation on the system - ports > > > ... and world ... and the kernel, > > > > Thanks for the warning --- Gentoo has something like that, too. > > Note that, having adjusted USE on Gentoo, 'emerge --newuse @world' will > cause the whole tree's dependency graph to be updated and all affected > packages recompiled. I don't think any of the BSD port systems have > this feature. You can achieve something similar with poudriere, updating the ports tree that it uses; rebuilding the rebuilding the things, then using `pkg upgrade` to update the system. I use portshaker to merge my personal ports collection (ports that haven't been merged or that I want to do differently from the standard) with the standard tree, which is nice. g. From owner-freebsd-questions@freebsd.org Mon Jul 15 22:32:45 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1866FC57D4 for ; Mon, 15 Jul 2019 22:32:45 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.126.131]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 1E4718317A for ; Mon, 15 Jul 2019 22:32:43 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([188.103.166.50]) by mrelayeu.kundenserver.de (mreue012 [212.227.15.167]) with ESMTPA (Nemesis) id 1MoeU5-1iFpEZ3yK9-00p94C; Tue, 16 Jul 2019 00:27:15 +0200 Date: Tue, 16 Jul 2019 00:27:10 +0200 From: Polytropon To: hw Cc: freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? Message-Id: <20190716002710.6d7c7800.freebsd@edvax.de> In-Reply-To: <87blxwosmj.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <20190715021053.2f82c84c.freebsd@edvax.de> <87blxwosmj.fsf@toy.adminart.net> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:DLb3sqtI0kYdvwVLba6uc9DPJOmjeVCS1m9ggxDfCANpeU95r9X 2TIDmcOm7iZblxZsT5PJd/SpGW9U/3MJMEI095vuAjmf0ptP1OFBJ7co12ujLRDn9v0kdJx HJIvbEFAofZbfLS08GmXx+2hdZuN3A4nSwoYC7u5kThlXsv4+ip3x28QJD9t37A+gwSz+c/ v/6qvAFN6wIJmFt0Lhk6Q== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:FdQCXNyDSe8=:YGPPG1qHgEHJA4MV8NGuDp J7tLEeUMejBiy4GB1v6W0av2Fr4Y9m1tCyGu1MEsE2YauiughLSQid1evAOJ5tbEEHG0MGarQ 0p8f+iOWZ5LOQptsLkCfI4J6QCcqsVP1I2Fx6/wreN74lZ5Eu/J97eVBmFlPgJDUrfe5FbfyB ambjGRBhSd6GscQUs6uV3A8qVYPWqKfDP3I6waZsGDRaMLTHQS4bylcvOd3tMzNOmR2oRiuCb nq4HyNcWOmwieKQJ80QBDDr07QLxbWmTvYMpa8TnV5XFmSltnVBK9dmc41I0uT94rMuTUZw1+ 9YbaocKp08Rv/dzBsGi/k5z5AIq/nv/di8ccvbno2xXNIgNYAmJcr7xaOr3n2K1b7n4YUBYEj c+3QtZlfnmHvs7tuavrTg6fI72ti8vEq6gCpRjEQqPrVjUqmEheFxj8hvjV4Vc4DMJupX2cPi VCet2OX+9Ge8LG0BapbWtSeHBb/C8eIl2ebNW8Gb4iyXvfeO8R6J3csAsUN59laKFphp4rUeJ vndMg/hwx8oM2RbKmumpUKoZgZ8RbudaAqnZjZzPiyGcj7eBAo7o6DJwUYQhqRRLFxsFO7GT7 3+V0OpZw/6AGB79DWlewCYb4D0PgLgGKDWZc/+sgdtCI71zjM8moKqV2SSmG3cRjs3e2shoBf JLUOsABLdxekFZkfXbOyCfZJmMc3j4HGXoub4IlxXo5S7pnN2ATPshJi4MuI+7MJGnRCj4x5P zWaiEgv4eiDL0/tl/D0iB+Gx4uT25qqpOl6ijsDXj74oVTFV/2KKr8O718o= X-Rspamd-Queue-Id: 1E4718317A X-Spamd-Bar: ++++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [6.90 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[cached: mx01.schlund.de]; RCPT_COUNT_TWO(0.00)[2]; RECEIVED_SPAMHAUS_PBL(0.00)[50.166.103.188.zen.spamhaus.org : 127.0.0.11]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.99)[0.995,0]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.93)[0.928,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000,0]; RCVD_IN_DNSWL_NONE(0.00)[131.126.227.212.list.dnswl.org : 127.0.5.0]; MID_CONTAINS_FROM(1.00)[]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; IP_SCORE(0.59)[ip: (1.99), ipnet: 212.227.0.0/16(-1.42), asn: 8560(2.39), country: DE(-0.01)] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 22:32:45 -0000 On Mon, 15 Jul 2019 05:59:16 +0200, hw wrote: > Polytropon writes: > > > On Mon, 15 Jul 2019 01:39:21 +0200, hw wrote: > >> Hi, > >> > >> so I wanted to see what would happen if I used a port and removed the > >> emacs-nox packages and its dependencies. Then I started installing the > >> emacs port. > >> > >> What is going on here? It seems as if I need to compile the whole > >> system myself now. > > > > That exactly is "using a port". A port is just a description > > of sources, tools to use, how to use them, and where to put > > the results. What you're seeing is to be expected: The port > > you're building (and its dependencies) will be compiled from > > sources, unless they're already installed in the correct > > version. > > There seems to be a lot more stuff needing compilation than the > dependencies of emacs-nox would suggest. Some of the dependencies are > quite surprising, like I would think a -nox version wouldn't need > support for JPEG2000 and not depend on things like font servers and all > kinds of other stuff. That seems to be normal. First, there are two kinds of dependencies: build dependencies (i. e., tools needed to build something), and runtime dependencies (obviously, libraries and such). Second, there is a "hierarchy of depencencies" (A requires B, B requires C, and so on). While those dependencies are automatically resolved, it can be possible that they need to be built in the correct version. There is a way to deal with it: List the dependencies ("make missing"), and feed that output into "pkg install". However, this will not always work, because if you change default options, dependencies might change (a la: A requires B and C; A enables feature X, this requires D, as well as a custom build of B with option Y enabled). So it won't always work that way. > I could as well recompile everything so it's all optimized for the CPU > it's running on. But are the defaults of the compile options the ones > used to compile all the binary packages, or are they different? The packages you obtain via "pkg install" have been built with the default options, and if you run "make install" without changing the options, you get, more or less, the same result. Tayloring your software to match CPU and optimize for the hardware has often been the first choice in the past, because you could get software running in a usable manner where the default install would have been "too slow" for your machine. This especially applied to multimedia software, where a wise selection of codecs and options would enable you do do wonders. However, this doesn't seem to be needed anymore, that's why "pkg install" often is the most convenient way to get stuff installed - as long as the default options work for you. Summary: It's widely suggested to use either ports only, or pkg only. Mixing both forms is possible (see "pkg lock" and the special tasks when updating your installed software), but it requires more work. Of course you can use poudriere (no idea why they gave it a name that's hard to spell and to pronounce, but well, that's "modern" today...) and provide a local repository with your custom-built software that you can "pkg install" from, but in cases where you only want one or two programs built from source, it's probably not worth the work. After all, you can choose how to do it, everything works. :-) -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Mon Jul 15 22:37:27 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1CBF4C5978 for ; Mon, 15 Jul 2019 22:37:27 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.126.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4AB51837D8 for ; Mon, 15 Jul 2019 22:37:26 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([188.103.166.50]) by mrelayeu.kundenserver.de (mreue009 [212.227.15.167]) with ESMTPA (Nemesis) id 1Mn2eN-1iCuIv07hX-00k7li; Tue, 16 Jul 2019 00:37:06 +0200 Date: Tue, 16 Jul 2019 00:37:05 +0200 From: Polytropon To: hw Cc: George Hartzell , freebsd-questions@freebsd.org Subject: Re: What does it mean to use ports? Message-Id: <20190716003705.eaa7db5f.freebsd@edvax.de> In-Reply-To: <87sgr7joq7.fsf@toy.adminart.net> References: <87o91wqjl5.fsf@toy.adminart.net> <23851.63340.445828.46420@alice.local> <87sgr7joq7.fsf@toy.adminart.net> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:BSEhWwFvz0yiMNYCvIP8QtxHjchPU+ys5Zr5ETVBXYVLy7Ua6UM KZy3ZpLbkjlA88BkHTV5lcco/x7d8UT0p/E0Iamzv64F6WK87LGmupxpRCX8zurCyyHGXF2 6bl3DYeuvWsMoXRHb1c+V/z+KyXEsxcDcTpeO6kU+2cYBupap5C6tyUY8fPVD+3sc8DN8l+ 14s393dB9NZPYx2WvLGYw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:Bb1IKsVRyA4=:JE/BVU2dXN3Ym6pvlryUPk mW5fu3atJI4K6Mbb1jh0DurNfC/py+2k9jmn7eJt6QNQLx3+I4PKuzkdXbgAvAdx05NnRe6na +stkQcH8VMG386hCEyE8eoWk6HhPPAjYWHuEiewWfhogndPCRyt+rMrb9C6IqQZwb0mQ869wA 6qqqYnAZoj9uZ8EJTkE40l2kzb2A1XYRLgOKnzYt3AFyBWLmCsP0qb2jQy0/Z78x/vJPO/6CO wSxDid6G2gkvfdrWjAX1VF2dVI8Q3iq+6asHPYOoNa4737GT0bMTKiqeJvcty6NpAiqXha6M3 hsTuPS+LQPrCTds5tYngkeKdy8iqv8cmwDCkgPQX8VXX+b/BQK77rUkloNWSSCJ4BLZP2NEly yWbzfY6fQ3v8MX/VTySBCgy8HfY00grPhffedlLvrOmes5vu5PSpM/FoJ/360ajMbKnjA+Fav s5PjdqyHheeFc+wHpQkctNqFQTDcXcu4nhJL7YHoaeleKGBUYq3iDNRycoTBSKBZ+2nu4jACT zd5yUynzDI+tAQKM06dC1E/LqS9HfWt7sAuO7ssxwhAVjhNMBYXiEON1BEEJWRJAVUVEq5Ls0 ROU5VVnOLOp3SKGr4HqP0yS/n0xY8mhnz5uoyQl7GQmMPq5Q+2nbxeAJwq5XDSASyEMqagh9D GtSnaP9Waw6pvRPXkSeRjl0LGTUvaNqjbuacFmgDRAdcvdifnZExQTmTFqEXhU8Hyen9IFPuK II53aSPjecs70+aou4rnwRDAVQV23P9la+rQLvWm/yzxF3+Bj5GtFMbheK4= X-Rspamd-Queue-Id: 4AB51837D8 X-Spamd-Bar: +++++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [7.07 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[cached: mx01.schlund.de]; RECEIVED_SPAMHAUS_PBL(0.00)[50.166.103.188.zen.spamhaus.org : 127.0.0.11]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.96)[0.962,0]; RCPT_COUNT_THREE(0.00)[3]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.96)[0.956,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000,0]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[133.126.227.212.list.dnswl.org : 127.0.5.0]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,meta]; IP_SCORE(0.76)[ip: (2.83), ipnet: 212.227.0.0/16(-1.42), asn: 8560(2.39), country: DE(-0.01)] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Jul 2019 22:37:27 -0000 On Mon, 15 Jul 2019 17:34:40 +0200, hw wrote: > George Hartzell writes: > > [...] > > > > The third hand (gripping hand, for you Pohl fans) is to build all of > > your things offline using poudriere/synth and then manage them with > > the pkg tools. It works best when you know what you want, and/or can > > be patient when you decide you want new things. > > Thanks! Somehow I thought this would be a lot easier --- and of course, > it isn't. For now, I'll stick with the binary packages until there's > good reason not to. Anything else is too time consuming because there > is so much that I need to figure out first. Once you have setup your build environment, you can automate a lot of things. But as you have seen, this requires some work upfront. However, if you need a lot of custom-built software, poudriere or synth are very convenient tools, and in the end, you can use pkg to interface with their results. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Tue Jul 16 00:22:58 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id F19CBC76DD for ; Tue, 16 Jul 2019 00:22:58 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 3595387363 for ; Tue, 16 Jul 2019 00:22:58 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563236575; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:Cc:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=340JAxiumE8iQoBVf7HDrYCoilV9UzCqeHfIz8Bewzg=; b=MkdpLpcZ0Ni5vuabtksW/ApQH6hAwFWXEAiQTSmJXHT639xqMyFF7VKykiXDvzFWp6 v3JgkVVnUSO2+CRe+53Nuwkj7WOvMzgsHrTTLSYhJipiSwM0fiJWGxixn4d72HKl71JN cPbswKB5h2h0QhzhoT4qb8ZLgaB7lMS7CO01DMc+7R0Iu6I+PussfZN9HEwSKnVtL3Lo kkEe0sOGJcmwpoFZ07dfRWbO7b0vjwFktSkATG+CtioFN4CR7s9bPzCrh0uv9WE7ISar 4YYnXkaMVlcT8DGfd4fXbshInLGRyJIkM+lj9mXr+v/5W4Nv32RBssOnutqnmFAjrlZG GkLQ== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6G0MtVwN (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate); Tue, 16 Jul 2019 02:22:55 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hnBF8-000139-FL; Tue, 16 Jul 2019 02:22:54 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hnBF7-0000bC-TO; Tue, 16 Jul 2019 02:22:54 +0200 From: hw To: "Kevin P. Neal" Cc: freebsd-questions@freebsd.org Subject: Re: dead slow update servers In-Reply-To: <20190715175108.GC31450@neutralgood.org> (Kevin P. Neal's message of "Mon, 15 Jul 2019 13:51:08 -0400") Date: Tue, 16 Jul 2019 02:19:47 +0200 Organization: my virtual residence Message-ID: <87k1cij0f0.fsf@toy.adminart.net> References: <874l3qfvqw.fsf@toy.adminart.net> <20190714011303.GA25317@neutralgood.org> <87v9w58apd.fsf@toy.adminart.net> <87v9w4qjy8.fsf@toy.adminart.net> <20190715014129.GA62729@neutralgood.org> <87ftn8otem.fsf@toy.adminart.net> <20190715151621.GB31450@neutralgood.org> <87blxvjn4a.fsf@toy.adminart.net> <20190715175108.GC31450@neutralgood.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 3595387363 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=MkdpLpcZ X-Spamd-Result: default: False [-3.71 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-0.99)[-0.988,0]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_SHORT(-0.89)[-0.885,0]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[adminart.net]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[adminart.net:+]; RCPT_COUNT_TWO(0.00)[2]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[8.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Jul 2019 00:22:59 -0000 "Kevin P. Neal" writes: > On Mon, Jul 15, 2019 at 06:09:25PM +0200, hw wrote: >> "Kevin P. Neal" writes: >> >> > On Mon, Jul 15, 2019 at 05:42:25AM +0200, hw wrote: >> >> "Kevin P. Neal" writes: >> >> > Oh, and my Dell machines are old enough that I'm stuck with the hardware >> >> > RAID controller. I use ZFS and have raid0 arrays configured with single >> >> > drives in each. I _hate_ it. When a drive fails the machine reboots and >> >> > the controller hangs the boot until I drive out there and dump the card's >> >> > cache. It's just awful. >> >> >> >> That doesn't sound like a good setup. Usually, nothing reboots when a >> >> drive fails. >> >> >> >> Would it be a disadvantage to put all drives into a single RAID10 (or >> >> each half of them into one) and put ZFS on it (or them) if you want to >> >> keep ZFS? >> > >> > Well, it still leaves me with the overhead of dealing with creating arrays >> > in the hardware. >> >> Didn't you need to create the RAID0s having a single disk, too? > > Yes, and that wouldn't change if I took your suggestion. Which is why I > phrased it as "it still leaves" which says that the problem already exists > and would continue to exist. So it's not more work as otherwise --- maybe even less because you have only half the number of logical drives, or less. >> > And it costs me loss of the scrubbing/verification of the end-to-end >> > checksumming. So I'm less safe there with no less work. >> >> If you're worried about the controller giving results that lead to the >> correct check sums and data ending up on the disk not matching these >> check sums when the controller reads it later, what difference does it >> make which kind of RAID you use? You can always run a scrub to verify >> the check sums, and if errors are being found, you may need to replace >> the controller. > > ZFS can correct checksum errors so long as the array is still valid. Is > there a hardware RAID card that does that? I'm not sure, some controllers do what they call surface checking in the background. It's the job of the controller to make sure the data on the disk is fine, and I have no reason to assume that it doesn't do that. >> > Maybe I should just go ahead and change it. I've got a drive about to >> > fail on me. It's a three way mirror so I'm not worried about it. It would >> > be, uh, _nice_ if it didn't bring down the machine, though. >> >> If you were using two or more disks each in a RAID1 or RAID10 to create >> one disk exposed to ZFS, you wouldn't have a problem when one disk >> becomes unresponsive. If there's someone around who is used to quickly > > True, but if I run a scrub I want to verify _all_ the data on the disks, > not just the data exposed by the RAID controller card. Why? Data that is never exposed is irrelevant for this and doesn't need to be verified. Of the logical volumes you're using now, the controller card exposes no more than it does, so what difference does it make of how many disks the volume is made of? You don't get any more or less data exposed as the controller does its thing regardless. Besides, how do you suggest to get all data exposed? Do you have special firmware on your disks that exposes all data, and for everything else that is involved? > That means ZFS needs to see _all_ the disks. Otherwise I would be > vulnerable to loss of data due to checksum errors that may only be > seen after a drive dies. At that point it's too late to correct. I don't understand how it would make a difference whether ZFS can see all physical disks or not. One way or another, there is merely a storage device ZFS is using and can see, and if the device is errorneous, it shouldn't matter what the device is physically made of. When a disk fails and is replaced, the hardware RAID is being rebuilt, and when ZFS detects checksum errors on that storage device, why shouldn't it be able to correct the errors like with any other storage device? It's even not the storage device that failed but only a disk. What if you had hybrid disks consisting of some flash memory and magnetic disks? You would have to conclude that they can never be used with ZFS because they could introduce hidden checksum errors. What about the cache of your disks, do you turn it off because hidden checksum errors could be introduced when there is a mismatch between the data on the disk and what is being exposed by the cache? IIRC, one of the advantages of ZFS is that you don't need to disable the cache. RAID controllers and such aren't designed to create hidden checksum errors ZFS is unable to correct. ZFS was designed to detect errors and to correct them, using check sums. There's no need to be afraid of RAID controllers and such. >> Hardware RAID does have advantages, so why not use them when you're >> stuck with it anyway? > > Because the downsides outweigh the upside. Like how? The whole setup seems very questionable, and the machine goes out of service right away when a disk becomes unresponsive. One of the purposes of RAID is to prevent just that. From owner-freebsd-questions@freebsd.org Tue Jul 16 00:22:58 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 71082C76DB for ; Tue, 16 Jul 2019 00:22:58 +0000 (UTC) (envelope-from lee@adminart.net) Received: from mo6-p00-ob.smtp.rzone.de (mo6-p00-ob.smtp.rzone.de [IPv6:2a01:238:20a:202:5300::7]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "*.smtp.rzone.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 0413187362 for ; Tue, 16 Jul 2019 00:22:56 +0000 (UTC) (envelope-from lee@adminart.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; t=1563236575; s=strato-dkim-0002; d=adminart.net; h=References:Message-ID:Date:In-Reply-To:Subject:To:From: X-RZG-CLASS-ID:X-RZG-AUTH:From:Subject:Sender; bh=b1Jl3hjFcvKQ1Bv/WJxEFSn2eWL4xGuXA05qOawmbb4=; b=JU60UgozfeTmmItdtxBTHsXFbGVjPqHvhwfSj8AU5dc7N4q4IHgwVm603AmODPOchd tCeE0yIqAPUh42vnL9rBTY5hLbbfGNz41ZJUbTNFjJE8bwY16puEd0OouTVEE1sIJTpR 2S/h4EeDINUVD2rRq0jlzu24J133XXLoolRZl2PHiNnAqJHxh/+kUbNe8B2WQb4bUHZv Dhauh20BxU4XcDEIXATRb1gsLQ32Se7qKE2FvMUQTJDw21ZxZrTvPdobACwLgmiIHZlh j3ABKx5DCL3YGOpFF80c2vBCvaTT6TWK7w4yejyZXtwADEU8qlSXqUHx2mGqS1BhNRrB av0w== X-RZG-AUTH: ":O2kGeEG7b/pS1FS4THaxjVF9w0vVgfQ9xGcjwO5WMRo5c+h5ceMqQWZ3yrBp+ARdaXvxIDf7nlw=" X-RZG-CLASS-ID: mo00 Received: from himinbjorg.adminart.net by smtp.strato.de (RZmta 44.24 DYNA|AUTH) with ESMTPSA id e0059dv6G0MtVwO (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (curve secp521r1 with 521 ECDH bits, eq. 15360 bits RSA)) (Client did not present a certificate) for ; Tue, 16 Jul 2019 02:22:55 +0200 (CEST) Received: from toy.adminart.net ([192.168.3.55]) by himinbjorg.adminart.net with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.92) (envelope-from ) id 1hnBF8-00013D-JF for freebsd-questions@freebsd.org; Tue, 16 Jul 2019 02:22:54 +0200 Received: from lee by toy.adminart.net with local (Exim 4.92) (envelope-from ) id 1hnBF8-0000bH-EC for freebsd-questions@freebsd.org; Tue, 16 Jul 2019 02:22:54 +0200 From: hw To: freebsd-questions@freebsd.org Subject: Re: make installworld failure for freebsd-12R (r349986) In-Reply-To: <20190714214137.GA45192@mon.zyxst.net> (tech-lists@zyxst.net's message of "Sun, 14 Jul 2019 22:41:37 +0100") Date: Tue, 16 Jul 2019 02:21:50 +0200 Organization: my virtual residence Message-ID: <87ftn6j0bl.fsf@toy.adminart.net> References: <20190714214137.GA45192@mon.zyxst.net> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.0.50 (gnu/linux) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 0413187362 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=adminart.net header.s=strato-dkim-0002 header.b=JU60Ugoz X-Spamd-Result: default: False [-3.73 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[adminart.net:s=strato-dkim-0002]; NEURAL_HAM_MEDIUM(-0.98)[-0.982,0]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[adminart.net]; MX_GOOD(-0.01)[cached: smtpin.rzone.de]; DKIM_TRACE(0.00)[adminart.net:+]; NEURAL_HAM_SHORT(-0.91)[-0.912,0]; R_SPF_NA(0.00)[]; FORGED_SENDER(0.30)[hw@adminart.net,lee@adminart.net]; RCVD_IN_DNSWL_LOW(-0.10)[7.0.0.0.0.0.0.0.0.0.0.0.0.0.3.5.2.0.2.0.a.0.2.0.8.3.2.0.1.0.a.2.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:6724, ipnet:2a01:238::/32, country:DE]; FROM_NEQ_ENVFROM(0.00)[hw@adminart.net,lee@adminart.net]; IP_SCORE(-0.73)[ipnet: 2a01:238::/32(-3.23), asn: 6724(-0.41), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Jul 2019 00:22:58 -0000 tech-lists writes: > and uuencode is present: > # which uuencode > /usr/bin/uuencode > > /tmp/install.pHuO1bS5/sh: uuencode: not found it's looking somewhere else From owner-freebsd-questions@freebsd.org Tue Jul 16 02:32:58 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EB587A37D2 for ; Tue, 16 Jul 2019 02:32:58 +0000 (UTC) (envelope-from clay.daniels.jr@gmail.com) Received: from mail-vs1-xe2e.google.com (mail-vs1-xe2e.google.com [IPv6:2607:f8b0:4864:20::e2e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id D7BA98C526 for ; Tue, 16 Jul 2019 02:32:57 +0000 (UTC) (envelope-from clay.daniels.jr@gmail.com) Received: by mail-vs1-xe2e.google.com with SMTP id u124so12854383vsu.2 for ; Mon, 15 Jul 2019 19:32:57 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=ujC8dG0T3qG4Pq1zOBuSX8/5QVQIYBW2kUHBp4fjkT8=; b=MRArylhaCKfv3YekUJnZZNnAJBuDD8z3QQN3/zGBmT7TSS2vlW9J7Z9mmsdGjHVR86 wpp5VNYoIAaJOvLKWFxKTHzV46oChLqNHWGjYiF2G5B0tIXGG4nLFxH0qLEcvam4gOeb esFlhFM8epjp5/vwReiTWEYJJA305XQWvrV3ueWNu0ZM6CAQKwtzd5e/8sfn5Rw14zWx egoMGBBQvvn27xTWdHt2hU8JeF9rriVt5JAE15fH4bm7mi4/epySjqdCsIvDEjCYSUJs 2MPNEG9VdJOXlfjhxK/nbhzsDCL2LKF534gt5fOYdff5Z9u8uZI29rBsuCQr7ZVWWINM irlw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=ujC8dG0T3qG4Pq1zOBuSX8/5QVQIYBW2kUHBp4fjkT8=; b=q1sHH1yv9SARhMQjZAB8qLDqt5pYDb1vlQ90czaNX9WaHTalUdQDVdHWwnfGNy2T03 ppzL8DeRSPzyHwu24ZAAdJNJdtngENPVoFBs9hWyUkiN+gvIXNUSf6i/U45mo9/9fQ8i v1XQfJ3ibJESuGqtE93bdqal4oAuOdw/PM1JwJPM3tQToOW1WehOh5oU90IYvMKzEO0I JlAC9uYi052wuioJJakQ2yudhtRWEgZqzd50l1N9fQrW9YzBc6Q2IU6FUroq0Y7RdxvO bHIgbvA1LMckPzRrJd3vzLkDWI3WVxeuT0fk6iCAdjNFJnt0kkf1XNXpr+HDE0/DnVgR sHkg== X-Gm-Message-State: APjAAAUJQr22Wm45lDNf4JPzfsjhMb0d2uXmW81hClq4nsdbm+z3gO/o FVmzGo4ZGqiXDl5gjbW4q4MQeXMU/Xw9tv3Unw== X-Google-Smtp-Source: APXvYqySYXYCpgm3dtiBxMPLVfxRbLWEEw0VSlWRBCoQtSGKhBn3VH+72HH3qjc0csaX1mBa5dkWkeUrX/t0zBLbUJ8= X-Received: by 2002:a67:e244:: with SMTP id w4mr18248896vse.176.1563244376957; Mon, 15 Jul 2019 19:32:56 -0700 (PDT) MIME-Version: 1.0 References: <3cf03a51-f7ba-379a-48a0-cddf159d6d12@gmail.com> In-Reply-To: <3cf03a51-f7ba-379a-48a0-cddf159d6d12@gmail.com> From: "Clay Daniels Jr." Date: Mon, 15 Jul 2019 21:32:45 -0500 Message-ID: Subject: Re: Need help to confirm hardware viability To: Kjell Tore Ullavik Cc: Manish Jain , "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: D7BA98C526 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=MRArylha; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of claydanielsjr@gmail.com designates 2607:f8b0:4864:20::e2e as permitted sender) smtp.mailfrom=claydanielsjr@gmail.com X-Spamd-Result: default: False [-6.34 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.56)[-0.561,0]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.996,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; MANY_INVISIBLE_PARTS(0.30)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[e.2.e.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.b.8.f.7.0.6.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-3.07)[ip: (-9.69), ipnet: 2607:f8b0::/32(-3.17), asn: 15169(-2.44), country: US(-0.06)]; FREEMAIL_CC(0.00)[hotmail.com]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Jul 2019 02:32:59 -0000 My suggestion is either of two AMD processors that have integrated video so you don't even need a separate video card: *AMD AM4 Ryzen 3 2200G 4 Core Processor with Integrated Radeon RX Vega 8 Graphics $99.57 at Fry's* *AMD AM4 Ryzen 5 2400G Processor with Radeon RX Vega 11 Integrated Graphics $162.99 at Fry's* On Mon, Jul 15, 2019 at 1:30 PM Kjell Tore Ullavik wrote: > > On 02.07.2019 19.58, Manish Jain wrote: > > Hi, > > > > > > My PC's hardware is beginning to fail, and I shall have to build a new > > box in the coming days. > > > > I need help from the list to confirm whether the following components > > work well with FreeBSD 12 : > > > > > > 1) AMD Ryzen 3 1200 Desktop Processor with Wraith Stealth Cooler > > (YD1200BBAEBOX) > > > > 2) Gigabyte GA-A320M-HD2 AM4 AMD A320 HDMI USB 3.1 Type-A ATX DDR4 > > Motherboard > > > > 2) Gigabyte (nVidia) GeForce GV-N710D3-2GL 2GB PCI-Express Graphics Card > > > > > > Any help would be greatly appreciated. > > > > > Been a happy user of nvidia and their closed source driver for a long time. > Only problem is the occasional incompatibilty with CURRENT. > > But, buying a graphics card now, I'd try to get the opinion of someone > familiar with the ongoing fbsd graphics work on whether AMD is a better > choice. > > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Tue Jul 16 09:15:54 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 072CDAA478 for ; Tue, 16 Jul 2019 09:15:54 +0000 (UTC) (envelope-from commerciale@maxsolutions.it) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id A751E72FBA for ; Tue, 16 Jul 2019 09:15:53 +0000 (UTC) (envelope-from commerciale@maxsolutions.it) Received: by mailman.nyi.freebsd.org (Postfix) id A4E39AA477; Tue, 16 Jul 2019 09:15:53 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A468FAA476 for ; Tue, 16 Jul 2019 09:15:53 +0000 (UTC) (envelope-from commerciale@maxsolutions.it) Received: from EUR01-DB5-obe.outbound.protection.outlook.com (mail-eopbgr150088.outbound.protection.outlook.com [40.107.15.88]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 812DE72FB8 for ; Tue, 16 Jul 2019 09:15:52 +0000 (UTC) (envelope-from commerciale@maxsolutions.it) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=WlU5dgGyC4c/zrJRgZYDHeXmWK+5djFQGyLuyB8jcXRorVA1hY71Uffh0Ir3DTKQq9w6VCmrbayNMduh0tyavQtm6V6Bhc9BElnX/LyMTUrEzBrmCX6PI3JI+B+0dOrP7/YYLoiS+FQghl7jQhgMoXvxdW8zZ21zfTO1J2hgGLDkacr8VVC+JH+Siapozk4LS67rBll3RGxP4oDjsOdmHbzILeAH980GOuwqe//7twNtWpjoHMiDCIoO9mLx95BSEPzCyRW1NBjT4YqwiBhFcvAFErwZ2X9aGLr1cGuFjV2WhnR2ywMbq83PwlfIPsr5bVci/BbrDy0UWSMxteKwZQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=NycLmg34Eh7VFs5fSv8oHUvGJMhU8sC8YOOrOjP3tLI=; b=Xt/SjhpPogUy6LI4Sk5Ml2Gf7y4VGz7pgOwWeL3DcjgqJyfjWlYY2FgAl86+J3JeDHkRc7s0F/VnIdPvtPY0zIeUgjexfVJYCcOyejUN8p9pF7N4eIWENDOIkztjXQvXxQ4hQf4rYpOdInOuZSMwAKi8mkecg1hsIR8CWxmSoQCN8CKffwjoVmmgnTK10/vcmog9n2qrOkdwzirgWZFTLdiW2jjjtoVVNRas+SM2rrmJwd8jxwcSxNE/frXZfItyjqcbpMLAjr/5epKIYSFTjaSjr462URcOa1Es+wexxUxw5NB1ss2wuOiBV4gsyGXCwJH8NQ9SKzBc0Zdq34PuKg== ARC-Authentication-Results: i=1; mx.microsoft.com 1;spf=pass smtp.mailfrom=maxsolutions.it;dmarc=pass action=none header.from=maxsolutions.it;dkim=pass header.d=maxsolutions.it;arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=maxsolutionssuzzara.onmicrosoft.com; s=selector1-maxsolutionssuzzara-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=NycLmg34Eh7VFs5fSv8oHUvGJMhU8sC8YOOrOjP3tLI=; b=Xb5QxUmzCgZUwc1ScZg1/0gFRpnrglWY3ILvkuhVs8XdfbgAl1bXIiyGMGMrDZvJ/rnt6xAhFw6GxW2t6t2DOMqS2yH2pEnntcQEa/RvvZnCRIn98GdYc9aBU1Ty/e8MUdxbBfecljMeXBAHxDg8PFRvtzxX95CjS618gXHz6eI= Received: from DB7PR07MB6121.eurprd07.prod.outlook.com (20.178.108.22) by DB7PR07MB5483.eurprd07.prod.outlook.com (20.178.84.145) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2094.7; Tue, 16 Jul 2019 08:59:49 +0000 Received: from DB7PR07MB6121.eurprd07.prod.outlook.com ([fe80::dd48:36d6:813:20f3]) by DB7PR07MB6121.eurprd07.prod.outlook.com ([fe80::dd48:36d6:813:20f3%5]) with mapi id 15.20.2094.009; Tue, 16 Jul 2019 08:59:49 +0000 From: "commerciale@maxsolutions.it" To: "questions@freebsd.org" Subject: HIT Srl + Maxsolutions Srl : collaboration in spare parts for port equipments Thread-Topic: HIT Srl + Maxsolutions Srl : collaboration in spare parts for port equipments Thread-Index: AQHVO7TS1Yf+AdDr+E2dM0SbRI+HKg== Date: Tue, 16 Jul 2019 08:59:48 +0000 Message-ID: Accept-Language: it-IT, en-US Content-Language: en-US X-MS-Has-Attach: yes X-MS-TNEF-Correlator: x-originating-ip: [95.245.79.175] x-clientproxiedby: MR2P264CA0042.FRAP264.PROD.OUTLOOK.COM (2603:10a6:500::30) To DB7PR07MB6121.eurprd07.prod.outlook.com (2603:10a6:10:90::22) x-mailer: Microsoft Outlook 15.0 x-ms-exchange-messagesentrepresentingtype: 1 x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 2d71e18f-2ec7-4ab7-27cb-08d709cbf4bf x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(7020095)(4652040)(8989299)(5600148)(711020)(4605104)(1401327)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(2017052603328)(49563074)(7193020); SRVR:DB7PR07MB5483; x-ms-traffictypediagnostic: DB7PR07MB5483: x-ms-exchange-purlcount: 1 x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:7691; x-forefront-prvs: 0100732B76 x-forefront-antispam-report: SFV:NSPM; SFS:(10009020)(39850400004)(396003)(366004)(136003)(376002)(346002)(189003)(199004)(733005)(236005)(55016002)(6306002)(2351001)(54556002)(54896002)(2906002)(71200400001)(861006)(71190400001)(5640700003)(25786009)(66066001)(8936002)(50226002)(606006)(9686003)(61296003)(14454004)(86362001)(6116002)(3846002)(53936002)(5660300002)(6436002)(6916009)(316002)(52116002)(66556008)(66476007)(476003)(81816011)(66576008)(386003)(186003)(7696005)(26005)(6506007)(102836004)(99286004)(66946007)(486006)(7736002)(256004)(81166006)(81156014)(478600001)(52536014)(62236002)(33656002)(2501003)(64756008)(1730700003)(66446008)(68736007)(74316002)(99936001)(8676002); DIR:OUT; SFP:1101; SCL:1; SRVR:DB7PR07MB5483; H:DB7PR07MB6121.eurprd07.prod.outlook.com; FPR:; SPF:None; LANG:en; PTR:InfoNoRecords; MX:1; A:1; received-spf: None (protection.outlook.com: maxsolutions.it does not designate permitted sender hosts) x-ms-exchange-senderadcheck: 1 x-microsoft-antispam-message-info: sVqljFY/QWfI4I1Fns9/YkSb+TCXuAxxC9pzVcHHsmYllcIP8khnd7YcwRNnvrZ3dqXuVwYMF5V/TKDyu1y/8SIYVOvH9+6jcwVPYHldPeOypEzDd4veCwLvEzqgmdSW11PVmci1stcJ1pvEzFoGejfpmmnaFNdiCpx4eZtjuND3GclKLIZb8nC2BLv/SS44p3ZxVkJbjS1ojpTEzEgrpoYwn1zY1sNFF4Tr3FJLZfpkv4HwKWs5n5gDx7C3IwNGbRrzKFFEwYXDtXG98iXHvGSt3Nue5l5kp7Yt9ZTW71k/zwaTcyzkjfk/sOsHU1MyIw+5irGahgpprkmTc1A6/46g64oJlUsLHIOle63D1m0+6uG8OKumlny5JlztQR3dlGBoRgRXduQqeg15wtDLUG3BmKtUVyLTUPGXdr5MGtg= MIME-Version: 1.0 X-OriginatorOrg: maxsolutions.it X-MS-Exchange-CrossTenant-Network-Message-Id: 2d71e18f-2ec7-4ab7-27cb-08d709cbf4bf X-MS-Exchange-CrossTenant-originalarrivaltime: 16 Jul 2019 08:59:48.8062 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 0893a540-0425-4670-863a-48fc3bd2fe68 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: commerciale@maxsolutions.it X-MS-Exchange-Transport-CrossTenantHeadersStamped: DB7PR07MB5483 X-Rspamd-Queue-Id: 812DE72FB8 X-Spamd-Bar: +++++++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=maxsolutionssuzzara.onmicrosoft.com header.s=selector1-maxsolutionssuzzara-onmicrosoft-com header.b=Xb5QxUmz; spf=pass (mx1.freebsd.org: domain of commerciale@maxsolutions.it designates 40.107.15.88 as permitted sender) smtp.mailfrom=commerciale@maxsolutions.it X-Spamd-Result: default: False [7.03 / 15.00]; HAS_XOIP(0.00)[]; R_SPF_ALLOW(0.00)[+ip4:40.107.0.0/16]; HAS_ATTACHMENT(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[maxsolutionssuzzara.onmicrosoft.com:+]; MX_GOOD(-0.01)[cached: maxsolutions-it.mail.protection.outlook.com]; NEURAL_HAM_SHORT(-0.04)[-0.040,0]; FROM_EQ_ENVFROM(0.00)[]; IP_SCORE(-1.04)[ipnet: 40.64.0.0/10(-2.91), asn: 8075(-2.22), country: US(-0.06)]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:+]; ARC_ALLOW(0.00)[i=1]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:8075, ipnet:40.64.0.0/10, country:US]; RSPAMD_URIBL(4.50)[hitsrl.com]; R_DKIM_ALLOW(0.00)[maxsolutionssuzzara.onmicrosoft.com:s=selector1-maxsolutionssuzzara-onmicrosoft-com]; FROM_DN_EQ_ADDR(1.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/mixed,multipart/related,multipart/alternative,text/plain]; DMARC_NA(0.00)[maxsolutions.it]; NEURAL_SPAM_MEDIUM(0.61)[0.614,0]; RCPT_COUNT_ONE(0.00)[1]; BAD_REP_POLICIES(0.10)[]; MANY_INVISIBLE_PARTS(1.00)[10]; NEURAL_SPAM_LONG(1.00)[1.000,0]; RCVD_IN_DNSWL_NONE(0.00)[88.15.107.40.list.dnswl.org : 127.0.3.0]; TO_DN_EQ_ADDR_ALL(0.00)[]; GREYLIST(0.00)[pass,body] X-Spam: Yes Content-Type: text/plain; charset="Windows-1252" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Jul 2019 09:15:54 -0000 Egregi clienti Siamo ad informarvi che in seguito alla ristrutturazione aziendale in corso= nella nostra azienda abbiamo ampliato alcuni nostri settori merceologici e= ridotto altri. La gestione del settore dei ricambi portuali =E8 stata da noi interamente e= d esclusivamente affidata alla: HIT Srl - Via Tosi 6 - 42124 Reggio Emilia Italia Contact Person: Mr. Paolo Soncini Email : info@hitsrl.com od in alternativa info@hitsrl.it = www.hitsrl.com Tel: +39 0522 1756017 Fax: +39 0522 1950023 HIT Prego vogliate rivolgervi a loro per qualsiasi vostra necessita in merito. Dear customers We inform you that following the ongoing corporate restructuring in our com= pany we have expanded some of our merchandise sectors and reduced others. The management of the port spare parts sector has been entirely and exclusi= vely entrusted to us by: HIT Srl - Via Tosi 6 - 42124 Reggio Emilia Italy Contact Person: Mr. Paolo Soncini Email: info@hitsrl.com or alternatively info@hitsrl.it www.hitsr= l.com phone: +39 0522 1756017 Fax: +39 0522 1950023 HIT Please contact them for any questions and inquiry you may have. Chers clients Nous vous informons qu'apr=E8s la restructuration en cours de notre soci=E9= t=E9, nous avons =E9tendu certains de nos secteurs de marchandise et en avo= ns r=E9duit d'autres. La gestion du secteur des pi=E8ces de rechange portuaires nous a =E9t=E9 en= ti=E8rement et exclusivement confi=E9e par: HIT Srl - Via Tosi 6 - 42124 Reggio Emilia Italie Personne =E0 Contacter: Mr. Paolo Soncini Email: info@hitsrl.com ou alternativement info@hitsrl.it www.= hitsrl.com Tel: +39 0522 1756017 Fax: +39 0522 1950023 HIT Veuillez les contacter pour toute question que vous pourriez avoir. = Managi= ng Sales Director = Lazzarin Lo= renzo [cid:image9367.jpg] From owner-freebsd-questions@freebsd.org Tue Jul 16 14:27:49 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D3947B0CF1 for ; Tue, 16 Jul 2019 14:27:49 +0000 (UTC) (envelope-from cyberleo@cyberleo.net) Received: from mail.cyberleo.net (paka.cyberleo.net [IPv6:2605:3e00::d8e2:80b4]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id CF64786E69 for ; Tue, 16 Jul 2019 14:27:48 +0000 (UTC) (envelope-from cyberleo@cyberleo.net) Received: from [IPv6:2001:470:1f11:36f:41c2:e60:1676:1c1a] (unknown [IPv6:2001:470:1f11:36f:41c2:e60:1676:1c1a]) by mail.cyberleo.net (Postfix) with ESMTPSA id 117B1905E4; Tue, 16 Jul 2019 10:27:40 -0400 (EDT) Subject: Re: FreeBSD host, multiple jails, many with web servers To: David Mehler , freebsd-questions References: From: CyberLeo Kitsana Message-ID: Date: Tue, 16 Jul 2019 09:27:40 -0500 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-GB Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: CF64786E69 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dmarc=pass (policy=none) header.from=cyberleo.net; spf=pass (mx1.freebsd.org: domain of cyberleo@cyberleo.net designates 2605:3e00::d8e2:80b4 as permitted sender) smtp.mailfrom=cyberleo@cyberleo.net X-Spamd-Result: default: False [-1.94 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; NEURAL_HAM_MEDIUM(-0.51)[-0.511,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2605:3e00::d8e2:80b4]; NEURAL_HAM_LONG(-1.00)[-0.999,0]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; NEURAL_SPAM_SHORT(0.38)[0.378,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; MX_GOOD(-0.01)[mail.cyberleo.net]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[cyberleo.net,none]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_TLS_ALL(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Jul 2019 14:27:49 -0000 On 6/30/19 12:09 PM, David Mehler wrote: > Hello, > > I've got a FreeBSD 12 host hosting about six jails, of which 3 now > have web servers, one more up and coming. I'm needing to get to these > web servers without doing as I'm doing now port redirection. I use Varnish to good effect for precisely this scenario, directing incoming requests to assorted backend jails based on the requested domain name. -- Fuzzy love, -CyberLeo Technical Administrator CyberLeo.Net Webhosting http://www.CyberLeo.Net Element9 Communications http://www.Element9.net Furry Peace! - http://www.fur.com/peace/ From owner-freebsd-questions@freebsd.org Wed Jul 17 02:42:52 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 406CEBFF05 for ; Wed, 17 Jul 2019 02:42:52 +0000 (UTC) (envelope-from list1@gjunka.com) Received: from msa1.earth.yoonka.com (yoonka.com [88.98.225.149]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "msa1.earth.yoonka.com", Issuer "msa1.earth.yoonka.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 624F088DD8 for ; Wed, 17 Jul 2019 02:42:51 +0000 (UTC) (envelope-from list1@gjunka.com) Received: from [10.70.7.24] ([10.70.7.24]) (authenticated bits=0) by msa1.earth.yoonka.com (8.15.2/8.15.2) with ESMTPSA id x6H2gi0j008540 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO) for ; Wed, 17 Jul 2019 02:42:44 GMT (envelope-from list1@gjunka.com) Subject: UnionsFS/whiteout on ZFS References: To: freebsd-questions@freebsd.org From: Grzegorz Junka X-Forwarded-Message-Id: Message-ID: <064a8527-5279-c914-67b9-0d5f2d21053f@gjunka.com> Date: Wed, 17 Jul 2019 03:42:39 +0100 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=windows-1252; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-GB X-Rspamd-Queue-Id: 624F088DD8 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of list1@gjunka.com designates 88.98.225.149 as permitted sender) smtp.mailfrom=list1@gjunka.com X-Spamd-Result: default: False [-6.60 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.993,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:88.98.225.149]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; DMARC_NA(0.00)[gjunka.com]; MX_GOOD(-0.01)[gjunka.com]; NEURAL_HAM_SHORT(-0.68)[-0.682,0]; IP_SCORE(-3.62)[ip: (-9.48), ipnet: 88.98.192.0/18(-4.74), asn: 56478(-3.79), country: GB(-0.08)]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:56478, ipnet:88.98.192.0/18, country:GB]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_TLS_ALL(0.00)[]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 02:42:52 -0000 Hello, With the ZFS on FreeBSD moving to ZoL, does anyone know what's the current status of supporting UnionFS on ZFS? Last time I checked FreeBSD implementation lacked the "whiteout" feature required to properly support deleting files in upper layers. Does OpenZFS or ZoL provide any updates to properly supporting UnionFS on ZFS? Thanks GrzegorzJ From owner-freebsd-questions@freebsd.org Wed Jul 17 04:06:55 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E3354A2BD0 for ; Wed, 17 Jul 2019 04:06:55 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out5-smtp.messagingengine.com (out5-smtp.messagingengine.com [66.111.4.29]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 41C8B8C3C8 for ; Wed, 17 Jul 2019 04:06:54 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 7C7BA223CE for ; Wed, 17 Jul 2019 00:06:53 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Wed, 17 Jul 2019 00:06:53 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:mime-version:content-type; s= fm3; bh=/x+IFeT5e/vi22arFLcvE7EkqyPXJLXtl9RhfpUZv4s=; b=QE/KDZPw 26A7DsG3mHa2H6kJ/Xx+2ftQXpAWCLbx9obx9lsxHzM0xzMDB/jXFSozh8qSoW9P zz9OzNrqONOMdsg6GZNQ6ib8rgoK1hgWOap3zqH9a9Q7jh+ZZ6MCI8fRodH2UFO2 UgRuIkDbMfY0hNGFpCTz4FtK0eu0pGStn4ZfXC93rkBHf7t67LVVW37CFvuSqZ7H F9nz77/c3qy9I76PSh94IwGNcup4iZLN6a6PmhLaquWCpRjZrzXdAZfwncixQ+fJ 4DzL+vAXfLDqdiZcfot/PE/N++sNWAeoYnUqI0Is3ZAPBS73aO2Wkz3mcrWV56yz Bm4RRH5GF11Ymg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-proxy:x-me-proxy:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=/x+IFeT5e/vi22arFLcvE7EkqyPXJ LXtl9RhfpUZv4s=; b=iXU1JPsWoqhd+2Bz7fjCaXR/SXGxJDCBrUW93fzCoMgnj 9TPCO8vUmw20FISJyxVF/Nam3VjZzNNYyOxM+vH4RUS++rI9KoZiJ05ipKPG+Nax 9Kipy3nX1EMDwFwv5vFwh/y0WFIidv0SG6npJ7iuQGDBZfCU89TrlFB00SsrgYjN xFdTTzcc10UrRaNmMI61Y7XlTFtAAHMlaCVNiGFzociS45ojp3LpBmzm8Tm+72EC FgrMe1FTX/zD1I4wTzjSM0dupQ+cTkxfkPqjAZ1kS9DYO1QWoruxnUpDhOJ+5VL3 yi35W5ldRfpO4Abl8n+upq1mw0udR24aH3uu73npw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddriedugdekudcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfggtggufgesghdtreertd ervdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseiihiig shhtrdhnvghtqeenucfkphepkedvrdejtddrledurdelleenucfrrghrrghmpehmrghilh hfrhhomhepthgvtghhqdhlihhsthhsseiihiigshhtrdhnvghtnecuvehluhhsthgvrhfu ihiivgeptd X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id AB2ED380083 for ; Wed, 17 Jul 2019 00:06:52 -0400 (EDT) Date: Wed, 17 Jul 2019 05:06:50 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: how to upgrade mysql56-server to mysql57-server? Message-ID: <20190717040650.GA55947@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="sdtB3X0nJg68CQEu" Content-Disposition: inline User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 41C8B8C3C8 X-Spamd-Bar: -------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=QE/KDZPw; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=iXU1JPsW; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.29 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-8.18 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.29]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; MX_GOOD(-0.01)[in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com]; NEURAL_HAM_SHORT(-0.94)[-0.944,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; RCVD_TLS_LAST(0.00)[]; IP_SCORE(-3.53)[ip: (-9.81), ipnet: 66.111.4.0/24(-4.78), asn: 11403(-2.99), country: US(-0.06)]; RCVD_IN_DNSWL_LOW(-0.10)[29.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 04:06:55 -0000 --sdtB3X0nJg68CQEu Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi, The default version of mysql/mysqld changed from 5.6 to 5.7 on 20190701.=20 The problem now is that if "pkg upgrade" is run, mysql-client is=20 upgraded and the existing mysql(56)-server is *removed*. mysql57-server is not installed. If mysql57-server is then manually installed with pkg install, when=20 "service mysql-server start" is run, it starts up then exits.=20 This error happens: [ERROR] InnoDB: The Auto-extending innodb_system data file '/var/db/mysql/ibdata1' is of a different size 4864 pages (rounded down to MB) than specified in the .cnf file: initial 4992 pages, max 0 (relevant if non-zero) pages! [1] This happens despite following the instructions in /usr/ports/UPDATING entry dated 20190701 for pkg. Basically, if you have a FAMP system and keep up-to-date with pkg, and you were using mysql56-server, just running pkg upgrade will leave you without any mysql server installed. It seems the only way of keeping mysqld at version 5.6 is to compile ports, which I didn't want to do (don't know if I can do) on this space-limited instance [2] [1] this was partially fixed by doing ls -lh on /var/db/mysql/ibdata1 (my file was 78MB) and then looking for the innodb_data_file_path =3D setting in /usr/local/etc/mysql/my.cnf and setting it like this:=20 ibdata1:76M:autoextend at least then it would start. However, running mysql_check reported errors when it got to the databases. Some innodb tables aren't being read, and I don't know how to fix these. [2] unless there is an exclude pattern that can be applied to pkg upgrade --=20 J. --sdtB3X0nJg68CQEu Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0untEACgkQs8o7QhFz NAWAXg//XU5mX6rPIb2DGlFn0/mGzEWNusO96E8xC4SBi0iSZ9b8AVUUpgBFmV5z 2wpxsH3vlbs/n0j8a/HbP6hdIR8lKqOWikkU27w/2cQAG6jr4rfK3icJth4BLV46 evH0YRiD/aWzjxsoipAeJeuYxvw0illQj53TYGk6wMRJaZr9Js/Bv82tICaL0Y50 ZtApbl+nv8DwEAYaPmHCyfwuXjjmxQJ8aortz7Y3rg3l4THULJOv3alcg8DMh6So Du3rnipguAI6EmcALfj8RjhoewJtKn8OeqRZgDKYwLxkTsLeemJPHRzvonB410J8 k68wFi8Sbe8/cwEUJL62uDwW5AfbXPBGR18+EzTjyg0cDsc5Cz1UOL0GpowfwF4J 8fMVXKrLSdLMQv3Hj6VEucroYeAfSBIpG53xuvzjPnrP34CXOZPQFM9tiLLeYqWs e+6UDDcI4iacGMzKygSqgmsvsSd3/pQFKItiBO7e6vB54m2O1A/mbUckriDx6Tjh yTRnIHujg9QYfDHDxY83cRq5xIpL+9pBuNapDKkDJbXlNb6SOjJHW3dOLeSz9wsG bdhciCeIE4Mpcd7wCdwF2mQcpTXuXL51KebDUEQeFb6M34oTZHskXg69tAGw6BqI V7CLkMhO6RsoPZqbQPshmD00OnVrpXT2+liDRuqCyr5sVWjOuS0= =MBxV -----END PGP SIGNATURE----- --sdtB3X0nJg68CQEu-- From owner-freebsd-questions@freebsd.org Wed Jul 17 09:06:28 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8A5B8A73D3 for ; Wed, 17 Jul 2019 09:06:28 +0000 (UTC) (envelope-from jmc-freebsd2@milibyte.co.uk) Received: from outmx-004.london.gridhost.co.uk (outmx-004.london.gridhost.co.uk [95.142.156.27]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id C51916F46C for ; Wed, 17 Jul 2019 09:06:27 +0000 (UTC) (envelope-from jmc-freebsd2@milibyte.co.uk) Received: from curlew.milibyte.co.uk (unknown [82.71.56.121]) (Authenticated sender: mailpool@milibyte.co.uk) by outmx-004.london.gridhost.co.uk (Postfix) with ESMTPA id 9FD9827FD4E24; Wed, 17 Jul 2019 10:06:09 +0100 (BST) Received: from [127.0.0.1] (helo=curlew.localnet) by curlew.milibyte.co.uk with esmtp (Exim 4.92) (envelope-from ) id 1hnfsz-0004YW-2D; Wed, 17 Jul 2019 10:06:05 +0100 From: Mike Clarke To: freebsd-questions@freebsd.org Cc: tech-lists Subject: Re: how to upgrade mysql56-server to mysql57-server? Date: Wed, 17 Jul 2019 10:06:04 +0100 Message-ID: <1569215.MsCH1bHPGx@curlew> In-Reply-To: <20190717040650.GA55947@mon.zyxst.net> References: <20190717040650.GA55947@mon.zyxst.net> MIME-Version: 1.0 X-SA-Exim-Connect-IP: 127.0.0.1 X-SA-Exim-Mail-From: jmc-freebsd2@milibyte.co.uk X-SA-Exim-Scanned: No (on curlew.milibyte.co.uk); SAEximRunCond expanded to false X-Rspamd-Queue-Id: C51916F46C X-Spamd-Bar: ++++ Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of jmc-freebsd2@milibyte.co.uk designates 95.142.156.27 as permitted sender) smtp.mailfrom=jmc-freebsd2@milibyte.co.uk X-Spamd-Result: default: False [4.30 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ptr]; IP_SCORE(0.51)[ipnet: 95.142.156.0/22(0.96), asn: 198047(1.69), country: GB(-0.08)]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; MID_RHS_NOT_FQDN(0.50)[]; DMARC_NA(0.00)[milibyte.co.uk]; NEURAL_SPAM_MEDIUM(0.53)[0.527,0]; NEURAL_SPAM_SHORT(0.70)[0.702,0]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[mail3.eqx.gridhost.co.uk]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_SPAM_LONG(0.97)[0.968,0]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[27.156.142.95.list.dnswl.org : 127.0.5.1]; MIME_TRACE(0.00)[0:+,1:+]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:198047, ipnet:95.142.156.0/22, country:GB]; SUBJECT_ENDS_QUESTION(1.00)[]; CTE_CASE(0.50)[]; FROM_EQ_ENVFROM(0.00)[] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: 7Bit X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 09:06:28 -0000 On Wednesday, 17 July 2019 05:06:50 BST tech-lists wrote: > [1] this was partially fixed by doing ls -lh on /var/db/mysql/ibdata1 > (my file was 78MB) and then looking for the innodb_data_file_path = > setting in /usr/local/etc/mysql/my.cnf and setting it like this: > ibdata1:76M:autoextend at least then it would start. However, running > mysql_check reported errors when it got to the databases. Some innodb > tables aren't being read, and I don't know how to fix these. You need to run mysql_upgrade and then restart the mysql server -- Mike Clarke From owner-freebsd-questions@freebsd.org Wed Jul 17 09:12:01 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4CBF8A76B7; Wed, 17 Jul 2019 09:12:01 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from echo.brtsvcs.net (echo.brtsvcs.net [IPv6:2607:f740:c::4ae]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 375036F8DD; Wed, 17 Jul 2019 09:12:00 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from chombo.houseloki.net (chombo [IPv6:2601:1c2:1402:1770:ae1f:6bff:fe6b:9e1c]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "chombo.houseloki.net", Issuer "brtsvcs.net CA" (verified OK)) by echo.brtsvcs.net (Postfix) with ESMTPS id 32D6838D03; Wed, 17 Jul 2019 02:11:58 -0700 (PDT) Received: from [IPv6:2601:1c2:1402:1770:f8c1:bed:71de:8ef1] (unknown [IPv6:2601:1c2:1402:1770:f8c1:bed:71de:8ef1]) by chombo.houseloki.net (Postfix) with ESMTPSA id 4F7BA59E5; Wed, 17 Jul 2019 02:11:57 -0700 (PDT) To: freebsd-questions@freebsd.org, freebsd-pkg@freebsd.org From: Mel Pilgrim Subject: pkg keeps wanting to install python27 but nothing uses it Message-ID: <123c17ef-c4a7-fa8d-5981-b5f15130972d@bluerosetech.com> Date: Wed, 17 Jul 2019 02:11:54 -0700 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 375036F8DD X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of list_freebsd@bluerosetech.com designates 2607:f740:c::4ae as permitted sender) smtp.mailfrom=list_freebsd@bluerosetech.com X-Spamd-Result: default: False [-6.51 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.998,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[bluerosetech.com]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[3]; IP_SCORE(-3.31)[ip: (-8.38), ipnet: 2607:f740:c::/48(-4.27), asn: 36236(-3.87), country: US(-0.06)]; MX_GOOD(-0.01)[echo.brtsvcs.net,foxtrot.brtsvcs.net]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.89)[-0.886,0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:36236, ipnet:2607:f740:c::/48, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_TLS_ALL(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 09:12:01 -0000 My systems have the public FreeBSD pkg repo disabled and instead install from a local repo built using poudriere. The current repo, built from branch 2019Q3 r506787, doesn't have a python27 pkg in it because everything uses python36. On a few systems (e.g., the poudriere build server), I must have the stock FreeBSD repo enabled. There, pkg insists on installing python27 from the FreeBSD repo. If I run pkg-autoremove afterward, it gets deleted, yielding an endless loop of pkg-upgrade insisting python27 needs to be installed, and pkg-autoremove insisting it doesn't. The usual incantation of: # pkg clean -a # pkg update -f # pkg upgrade -f didn't fix it. Why is pkg insisting I have python27 installed? From owner-freebsd-questions@freebsd.org Wed Jul 17 10:49:18 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 52597A92CF for ; Wed, 17 Jul 2019 10:49:18 +0000 (UTC) (envelope-from damian@cretivedigitalagency.com) Received: from mail-qt1-x841.google.com (mail-qt1-x841.google.com [IPv6:2607:f8b0:4864:20::841]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F7F57300E for ; Wed, 17 Jul 2019 10:49:17 +0000 (UTC) (envelope-from damian@cretivedigitalagency.com) Received: by mail-qt1-x841.google.com with SMTP id n11so22796688qtl.5 for ; Wed, 17 Jul 2019 03:49:17 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cretivedigitalagency-com.20150623.gappssmtp.com; s=20150623; h=mime-version:sender:from:date:message-id:subject:to; bh=dyAgSfKur6i/O3VtTkT/AQTaOCeN90XZ+GC4if4OaEw=; b=jvU6aa6/3EyBM1lxuv/8KzX8iOEVKJHX+XzKTntrC15d6CT0ClOolpHtB4IiBvwGwm kPHO7v+Q07Cz0DlfOxVrjrCA2QVNYzGtudnnpRGum5OZoc7lw/CCE7cxMwe18Lv2dzO4 CiLcXjBKMK+/3gb0+PAYq/zzkI+w6I4UljEG6sobB9SOf4eGZnUUyAY7tnpd4wW9Bj+b rPGzJFmYKu0W7B77Quwof8/3jbtZjpGSviV9jv60CFtuXS3Y3c/0lqvjWEi5P+fEHid4 W7SsZd9b88mImwCj8tqafpgCIjczcsvZ8wsTTJDt6++6MSIQmpoWbkmxbTHRXojeTTCd wldw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:sender:from:date:message-id:subject :to; bh=dyAgSfKur6i/O3VtTkT/AQTaOCeN90XZ+GC4if4OaEw=; b=TDiu2QI1guef4r3arKfxIQx/ylTLVn9IczZ1c92tkn7L8Kxig60SYjXbubNZ5eWCRk tau9sBLaL1z1DsirHvp/VZlqXsHkxa5Gy14WjtK2/Or71pvneDC1WbWWKbkfP7v4Ib1B 0KD1wuzKkgUPUGs/LGqUgO9b2eeCDSL7s19BAdEUdx73T7n8vXMJ81koR3ejBa+jIVfR AijVy9OgNuoeIBaEth6edsHgFB0FfXeuwD6gbofs3KCKcsjlQJll0FZ68vuaGCrc9BDV rJntEI3Zak1CzhKUpn9WZHPljPXR/2zFO+15VRLye90DsXYQ96dg54c1Uq/pHP+fAvDb gVRg== X-Gm-Message-State: APjAAAWg1r8fdLkYsaiI25wZlUubuGFC/0uM3B5Zl9/E5ooPjfy+I61R NWFRS1BWdk1Pdi9l5KHsEJA+cS3tZ9kGBLaNea+PMQ== X-Google-Smtp-Source: APXvYqxrK7Wac6ANMcmfhWtAgKMwtxj8ir6iG5oz4aQabs2/tUqBZg1REsX8VUHw9yGjaueXCwsvmiG+1O9X/nxKxoY= X-Received: by 2002:a0c:b0e4:: with SMTP id p33mr28776500qvc.208.1563360556697; Wed, 17 Jul 2019 03:49:16 -0700 (PDT) Received: from 52669349336 named unknown by gmailapi.google.com with HTTPREST; Wed, 17 Jul 2019 03:49:15 -0700 MIME-Version: 1.0 Sender: Damian From: Damian Date: Wed, 17 Jul 2019 03:49:15 -0700 X-Google-Sender-Auth: kmBEIL6lzZehOONVpv1BoIEnl8k Message-ID: Subject: Re:Freebsddiary.org, Suggestions to increase your business To: Freebsd-Questions X-Rspamd-Queue-Id: 4F7F57300E X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=cretivedigitalagency-com.20150623.gappssmtp.com header.s=20150623 header.b=jvU6aa6/; spf=pass (mx1.freebsd.org: domain of damian@cretivedigitalagency.com designates 2607:f8b0:4864:20::841 as permitted sender) smtp.mailfrom=damian@cretivedigitalagency.com X-Spamd-Result: default: False [-2.08 / 15.00]; ARC_NA(0.00)[]; FAKE_REPLY(1.00)[]; R_DKIM_ALLOW(-0.20)[cretivedigitalagency-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-0.97)[-0.973,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[cretivedigitalagency.com]; URI_COUNT_ODD(1.00)[1]; RCPT_COUNT_ONE(0.00)[1]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[cretivedigitalagency-com.20150623.gappssmtp.com:+]; MX_GOOD(-0.01)[cached: alt1.aspmx.l.google.com]; RCVD_IN_DNSWL_NONE(0.00)[1.4.8.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.b.8.f.7.0.6.2.list.dnswl.org : 127.0.5.0]; NEURAL_HAM_SHORT(-0.87)[-0.869,0]; NEURAL_HAM_LONG(-1.00)[-0.999,0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; IP_SCORE(-0.73)[ip: (1.99), ipnet: 2607:f8b0::/32(-3.15), asn: 15169(-2.43), country: US(-0.06)] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 10:49:18 -0000 Hi Freebsddiary.org, Hope you are doing fantastic. I am Damian Smith Sr. Web Analyzer having 9+ years of experience in Search Engine Marketing, Social media Marketing, Content Marketing, Pay-per-click, Video Marketing etc. While analyzing your website, we tracked some pitfalls for which your website doesn=E2=80=99t show up within top search results on search engines including Google. In addition to the same, we found that Freebsddiary.org is not able to achieve appropriate traffic/visitors for a couple of months. I am quite impressed with your website - Business Concept, Content, Call-to-Actions and others. As a web analyzer, I can recommend few things to improve the website performance and I hope my suggestions will help business & your website. My suggestions: =E2=80=A2 Publish Relevant Content (Blogs, Micro blogs, Article, Bus= iness Bio and etc) =E2=80=A2 Update Your Content regularly for quick crawling =E2=80=A2 Go for variation keywords and website optimization =E2=80=A2 Update Best Title Metadata, Description Metadata, Keyword = Metadata =E2=80=A2 Go for Social media marketing for more engagement and soci= al media traffic =E2=80=A2 Work on Page Loading speed and fix it to load within secon= ds =E2=80=A2 Go for Content marketing and Video marketing =E2=80=A2 Implement Latest Industry Specific Schema so you stand out= as compared to your competitors=E2=80=99 not sure, if you can understand all above technical terms or not. Not to be worried, I will help to make you understand about the above points with brief descriptions. If you have a technical team then I will wish you to go ahead and work on the above factors or if you prefer then I can help you to work on the above points. If you are comfortable to go for a online meeting then please let me know. If you need to know about the cost then please revert back to my email and I will be happy to send you the quote with brief recommendation. Thanks, I look forward to your reply. Regards, Damian Smith Web Analyzer [image: beacon] From owner-freebsd-questions@freebsd.org Wed Jul 17 12:38:50 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A947FABD4B for ; Wed, 17 Jul 2019 12:38:50 +0000 (UTC) (envelope-from donald@digitalmarketingline.com) Received: from mail-lf1-x143.google.com (mail-lf1-x143.google.com [IPv6:2a00:1450:4864:20::143]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id A40B877869 for ; Wed, 17 Jul 2019 12:38:49 +0000 (UTC) (envelope-from donald@digitalmarketingline.com) Received: by mail-lf1-x143.google.com with SMTP id p197so16337312lfa.2 for ; Wed, 17 Jul 2019 05:38:49 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=digitalmarketingline-com.20150623.gappssmtp.com; s=20150623; h=mime-version:sender:from:date:message-id:subject:to; bh=q5ww7JmV5ULS792vtx8hVxHdLvHGdjYeeS8kuWdsB9g=; b=1XpAjddUzg/3yPMqPw5v28DJbASSx+SJELkCp9/4kOV92ZpNgaTvelCCT9lCb5m6te FS5Lz45MYHx9YJTxTl3jIOBccN2MR3QzE0Iip3lYa2CjPszgjGVpb8IAxeWosyImF7sm cRnMy9+zFgvmvqQIZ0DLALz3mlN+H5/R1heqUCcLAYsGoG6pO7ksACiVYquGGgHnNJdY K8Gvu1061Uy6Z/fqSNyijqAj6+tlHrAEaLVcdvxSRnniNtv0CWKPllPvli+lOypvgAIh 1wfaVtQy1QiENR/Ba4ud+N3fvkTHQMipeSaB97d7Z6tdytv0o+r5nRQI8vBOx6MXXBs7 i0DQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:sender:from:date:message-id:subject :to; bh=q5ww7JmV5ULS792vtx8hVxHdLvHGdjYeeS8kuWdsB9g=; b=HNp7euQtYgODeME3Fply+jgjZMNH8Q9vo/iiySVk0jwg5xhDNAQ2AkI9sxWSnrdo0T B6us/YYdghiiIppXVSUxw81mdZcKeaVhiD8Ozuwba4Y0m/NadEdpBzvEC5WNmr88IEQu IpGwYC++CT4JfACGDZf71VcnyNH5xlwzY5s30GtjxK0lenos0SgF2aVneQyTdqbfISDn weaAtJKHQPSFsoulhroZ+0r4hcQkAGLifx0d9sHAV1Ym8SCqE4bY8MQ4iAbgvvtuoRgT tcUNJuBi0tqHdkdo9S/ZPSM+A+poCR3rhOQt76GiRVIrEYeByeSfKX1qPo0vH6hHYX9g MGtw== X-Gm-Message-State: APjAAAWFSy5m77frkj+7UpsXkIw9hKk66QxdDM1s8Pm/T21xsDdVeADH XFgSmUJRTP2MiXDNzdWtouEIdcKnbMawcO4BR2PKzg== X-Google-Smtp-Source: APXvYqyoPEXcQErUHtLd8VpaMIZBi2vSljKj/yZR6FZPL3Cb7WuN67cBfUNQwM32hKttXDXe2UJm83kHrFh+1MlFPY0= X-Received: by 2002:a19:7006:: with SMTP id h6mr17615020lfc.5.1563367128030; Wed, 17 Jul 2019 05:38:48 -0700 (PDT) Received: from 52669349336 named unknown by gmailapi.google.com with HTTPREST; Wed, 17 Jul 2019 05:38:47 -0700 MIME-Version: 1.0 Sender: Donald From: Donald Date: Wed, 17 Jul 2019 05:38:47 -0700 X-Google-Sender-Auth: 7oZ5480jXC6T6rxsbvBqo9cisFo Message-ID: Subject: Re: Secure Freebsddiary.org from google penguin 4.0 To: Freebsd-Questions X-Rspamd-Queue-Id: A40B877869 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=digitalmarketingline-com.20150623.gappssmtp.com header.s=20150623 header.b=1XpAjddU; spf=pass (mx1.freebsd.org: domain of donald@digitalmarketingline.com designates 2a00:1450:4864:20::143 as permitted sender) smtp.mailfrom=donald@digitalmarketingline.com X-Spamd-Result: default: False [-2.18 / 15.00]; ARC_NA(0.00)[]; FAKE_REPLY(1.00)[]; R_DKIM_ALLOW(-0.20)[digitalmarketingline-com.20150623.gappssmtp.com:s=20150623]; URL_IN_SUBJECT(0.40)[freebsddiary.org]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[digitalmarketingline.com]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-0.996,0]; MANY_INVISIBLE_PARTS(0.30)[4]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[digitalmarketingline-com.20150623.gappssmtp.com:+]; MX_GOOD(-0.01)[cached: alt1.aspmx.l.google.com]; RCVD_IN_DNSWL_NONE(0.00)[3.4.1.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0]; NEURAL_HAM_SHORT(-0.88)[-0.880,0]; NEURAL_HAM_MEDIUM(-0.95)[-0.947,0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; IP_SCORE(-0.55)[ip: (2.65), ipnet: 2a00:1450::/32(-2.91), asn: 15169(-2.43), country: US(-0.05)] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 12:38:50 -0000 Hello Freebsddiary.org , How are you doing today? I'm sure you have been contacted regarding this before but our value proposition is much unique. As a business owner, you might be interested to attract more visitors. So you might be wondering, despite having a proficient website, why you are not able to overturn your competitors from the Top Search Results. If you could spare a couple of minutes, I could provide you a concise idea about it. To start with this is Donald Harris, A Digital Marketing Expert. While doing a search, found that Freebsddiary.org is not on the 1st Page of Google. So thought you might be interested to know about the causation for the low performance of Freebsddiary.org . Most recently Maccabee update has become the talk of the town. Phantom is the name given to random updates that Google brings every now and then. This means websites having a single un-natural link are going to be penalized. Moreover, growing preference for Mobile-Friendly Pages to help website owner=E2=80=99s gain and hold more visitors to a website has been rolled ou= t. So, we can help transform Freebsddiary.org into one. *Why Freebsddiary.org Needs Our Assistance:* - Freebsddiary.org has low Domain Authority and Page Authority. - Relevant keyword phrases are not on 1st Page. - Freebsddiary.org has Coding Errors. - Freebsddiary.org is having On-Page and On-Site Issues. We can help address above Issues, and Place the website in TOP Search Results. I guarantee 100% satisfaction, as we only deal in White Hat Process. Makes Sense!!! Drop us an email with your questions, we will answer your questions. Have a Great Day. Thanks & Regards, Donald Harris| (Digital Marketing Expert) ---------------------------------------------------------------------------= -------------------- Disclaimer:-If Interested we will send more details on our =E2=80=9Ccorpora= te identity=E2=80=9D, =E2=80=9Ccompany profile=E2=80=9D, =E2=80=9Cwhy you shou= ld choose us?=E2=80=9D, =E2=80=9CPrice list=E2=80=9D, etc. in our next email. If Not, You can simply reply with =E2=80=9Cremove= =E2=80=9D and we will delete your email from our list. "The CAN-SPAM Act of 2003". ---------------------------------------------------------------------------= -------------------- [image: beacon] From owner-freebsd-questions@freebsd.org Wed Jul 17 13:07:34 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 60855AC656 for ; Wed, 17 Jul 2019 13:07:34 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out1-smtp.messagingengine.com (out1-smtp.messagingengine.com [66.111.4.25]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 7FB4680A1B for ; Wed, 17 Jul 2019 13:07:33 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 59228220CF for ; Wed, 17 Jul 2019 09:07:27 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Wed, 17 Jul 2019 09:07:27 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm3; bh=4kXOySJKYISZ0pCdN7MTo8v1AhC t35O0ohcxewHik3s=; b=goTHwy7XYo0fGDLcOc0ibVfNVjquSY3j2F57xYnElEa Ge+rU+dl1V9INA5qEiyxMoOt41aWuHvxEf/wlbWsursxKJTJWqCajYNTXL6UhMSE 2jB/Qjj3YO/P2Tpk9JQXAVjEDFvlT9I+krNQ4MgYo8j4gJy6OXcJitZKBkLQBD/S LCugp6YqLSEaHMjG6uGv+ml60CgLKmIkBJcynTlmXrYuaFwSx+rCvkEwk7B+cXly GQ5i0enIxbnv+dJh9jKcKD3eoUwWYXoY1ku09+Itox+QpBXHHARS6HjjQ3Yv20Bz QCteeT3sJHKaayCtXyx8QRSuEiKV/IU6imJBjp/HgCQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=4kXOyS JKYISZ0pCdN7MTo8v1AhCt35O0ohcxewHik3s=; b=b8T8ei+wDA1VLHHd5Gp9ls AduOWYsQAGGKpk865pXu0VI3XkHT6xjZkUYYQCVXB8G4PHWTeVL/pfT98F5W+xsf ehr1o8OCT/GZrAwbA+UdxCSEeG0xfx9+Ut8mJeYDKVJRSlMHyRp0OmV66oGZNNWX leBHFDpS2srwokVDbWZsWuEM06YKgO8xk5kRG0s3bz2bHGHCyZYVPDY/T54xbtaV h5urLM1Ez1B+u7h7zXpve4Ft4z4LEX7BATuZOvF+a1FuUHCCsQnoy0LmhhHqcFNm jX4zyi4DPrtJu159zka6UJvHFTgZzF7ZInI4ppvajhxiFCId3a1YzvRe0MMROzfQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieefgdefjecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjfgesghdtre ertdervdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseii hiigshhtrdhnvghtqeenucfkphepkedvrdejtddrledurdelleenucfrrghrrghmpehmrg hilhhfrhhomhepthgvtghhqdhlihhsthhsseiihiigshhtrdhnvghtnecuvehluhhsthgv rhfuihiivgeptd X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id 83D6280059 for ; Wed, 17 Jul 2019 09:07:26 -0400 (EDT) Date: Wed, 17 Jul 2019 14:07:24 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: Re: how to upgrade mysql56-server to mysql57-server? Message-ID: <20190717130724.GA56923@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org References: <20190717040650.GA55947@mon.zyxst.net> <1569215.MsCH1bHPGx@curlew> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="CE+1k2dSO48ffgeK" Content-Disposition: inline In-Reply-To: <1569215.MsCH1bHPGx@curlew> User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 7FB4680A1B X-Spamd-Bar: -------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=goTHwy7X; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=b8T8ei+w; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.25 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-8.17 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.25]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; MX_GOOD(-0.01)[cached: in2-smtp.messagingengine.com]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-0.99)[-0.990,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; RCVD_TLS_LAST(0.00)[]; IP_SCORE(-3.47)[ip: (-9.52), ipnet: 66.111.4.0/24(-4.78), asn: 11403(-2.98), country: US(-0.05)]; RCVD_IN_DNSWL_LOW(-0.10)[25.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 13:07:34 -0000 --CE+1k2dSO48ffgeK Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Wed, Jul 17, 2019 at 10:06:04AM +0100, Mike Clarke wrote: >On Wednesday, 17 July 2019 05:06:50 BST tech-lists wrote: > >> [1] this was partially fixed by doing ls -lh on /var/db/mysql/ibdata1 >> (my file was 78MB) and then looking for the innodb_data_file_path =3D >> setting in /usr/local/etc/mysql/my.cnf and setting it like this: >> ibdata1:76M:autoextend at least then it would start. However, running >> mysql_check reported errors when it got to the databases. Some innodb >> tables aren't being read, and I don't know how to fix these. > >You need to run mysql_upgrade and then restart the mysql server Sorry, I meant mysql_upgrade. Like this: # mysql_upgrade root@localhost -p Enter password:=20 Checking if update is needed. Checking server version. Running queries to upgrade MySQL server. Checking system database. mysql.columns_priv OK mysql.db OK [...] lots of this, ends here: mysql.user OK Upgrading the sys schema. Checking databases. Error occurred: Error during call to mysql_check. This still happens even if the process is repeated. The only difference in output: mysql.user OK The sys schema is already up to date (version 1.5.1). Checking databases. Error occurred: Error during call to mysql_check. [...] So it seems mysql_upgrade invokes mysql_check. Nothing usable in the error log; I can't see which tables are malfunctioning. The way I can tell is indirectly, when the=20 mysqld-enabled site loads, there is missing information. --=20 J. --CE+1k2dSO48ffgeK Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0vHYIACgkQs8o7QhFz NAUpYQ//TelZlrL+cQB5cUJyMiSB2b00rm/S5PqoksZTi6D537BJZjA7mr9HhBrX pqi/enxmhaf94NCtIeyjtFaWQxrtlwzxL8igq5fggeOOW7VTL8sNyUgCoIcZcsba PBchz+mqRCAegHTWtngHZl8sbau0jQUGl/4LJUauiRkfoLT4zSNo2SSe60ZualTs zp1vf3uKKBo6k/Z4SceuW3ZcPyO+Fwb9LT9EALKw5hnVEPiiIY+3kAnQHQhRW1JB csaCeEdZ860qozg389iHwft3zC/KHqKpjaMUOhanGQCJZdZ2h/ds5m5ej5ZRuAHP uykdgAb9WB2p6UctToK7/oH5Ppt2c+BDUfu7TSnZYKHha69Z2TtQjMhZeJo/ZDe6 tuWP4GSSp7oqoTgvV704CSLma4cE2ScgG71f2VD81Vde/BBFwbaYLOfSFaFys3Hh aQ1aGWZ60p3eahgIRhn9+jTx8uBvG9TelGwvB/cBFSwWtJXox8iwBzORWJzHw6/H VhYg4BqoGzIzEKwalejZnWPZKdu2Y0312UBRI9kb3fZmcvFdHDxSO+ihzjCKH9F0 7Kw/vvVUbFN9XLbFG2rwkzkxzEQ7QczxeJkspO5nMK0LChmqZBjFYYTM109sp9N1 TeOWmDv0eTI589FjdDaG+X3+5M+78qI8jfaEn1zWuI3Exf5Jnow= =He/j -----END PGP SIGNATURE----- --CE+1k2dSO48ffgeK-- From owner-freebsd-questions@freebsd.org Wed Jul 17 13:42:57 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 289CDAD1B9 for ; Wed, 17 Jul 2019 13:42:57 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out2-smtp.messagingengine.com (out2-smtp.messagingengine.com [66.111.4.26]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 3C07B8214E for ; Wed, 17 Jul 2019 13:42:56 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id AE572220CA for ; Wed, 17 Jul 2019 09:42:50 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Wed, 17 Jul 2019 09:42:50 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm3; bh=dyrcnzFWELkAIbDrqsl7mshgAM4 T5C9ckqMd7HooFpw=; b=OIWlgWP/pjob6YmSA7sIf43o/0exPBN0jeKK+liAo5Z A8t0DpSma6mXeZArh+mkJ6EgVuO0y7lnnPVA2M8etvJ40ud9hIUfGZFcOz9LTFdB NEcgOp86qHcdWHeK4l4d6K/8/ra8jy6g7yIz3rSeUORRxVMnoH4oO26bbfmn2CKq 0Nn4JnjpydtIfBIV7eJNNmPv3gx1TmojTNlV4kXEtp7nSdrlwaodjfyCBHtVRgYb fwqbgj9hVh4+fxx3G4598v5iv9iZt8E4Zz95k7MGxKqhCRpex2WN2FjSs3gIJPYd SOs1YsA9VQ2hpdBbmGb8AwadMCvFmo10Hf4NO7mcrVw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=dyrcnz FWELkAIbDrqsl7mshgAM4T5C9ckqMd7HooFpw=; b=ZZbsAj3/XSbV4BLq0sLelB vqg8tVb2V4GmTuMhM4feRHPyNs8XIO8bFjwpBhmTBKYUlCwsYZLXyYbNP052hqHA c2AgFyIPK9M3fHScpxuI+jbpKca1a6TbWzasR417QrR172dq9cnKREDQoHmLKzRK lEZsP76Lf/JbrJrA9YVf/TSkMf+mgsDWNv+QWgQ9z2m1GReB1cKI2dLlxHqfZMm/ +gAU/x55vb6079L5wsqj6QTP/aTYtk5qiYoGQWhNlVrvm1YTOawpaUVC5PNmOprj AEC2Qd52mGcXK0Vs6nmTEdIJKhpNE7TFQS8pK8UEpH8MZSQ5xF/EXwixBxXPUDhw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieefgdeggecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjfgesghdtre ertdervdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseii hiigshhtrdhnvghtqeenucfkphepkedvrdejtddrledurdelleenucfrrghrrghmpehmrg hilhhfrhhomhepthgvtghhqdhlihhsthhsseiihiigshhtrdhnvghtnecuvehluhhsthgv rhfuihiivgeptd X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id F217C80063 for ; Wed, 17 Jul 2019 09:42:49 -0400 (EDT) Date: Wed, 17 Jul 2019 14:42:47 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: Re: make installworld failure for freebsd-12R (r349986) Message-ID: <20190717134247.GA58456@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org References: <20190714214137.GA45192@mon.zyxst.net> <87ftn6j0bl.fsf@toy.adminart.net> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="X1bOJ3K7DJ5YkBrT" Content-Disposition: inline In-Reply-To: <87ftn6j0bl.fsf@toy.adminart.net> User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 3C07B8214E X-Spamd-Bar: --------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=OIWlgWP/; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=ZZbsAj3/; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.26 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-9.16 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.26]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; MX_GOOD(-0.01)[cached: in2-smtp.messagingengine.com]; NEURAL_HAM_SHORT(-0.97)[-0.970,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; IP_SCORE(-3.48)[ip: (-9.55), ipnet: 66.111.4.0/24(-4.78), asn: 11403(-2.98), country: US(-0.05)]; RCVD_IN_DNSWL_LOW(-0.10)[26.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 13:42:57 -0000 --X1bOJ3K7DJ5YkBrT Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Jul 16, 2019 at 02:21:50AM +0200, hw wrote: >tech-lists writes: > >> and uuencode is present: >> # which uuencode >> /usr/bin/uuencode >> >> /tmp/install.pHuO1bS5/sh: uuencode: not found > >it's looking somewhere else re-getting sources and rebuilding 48 hrs later made the problem disappear --=20 J. --X1bOJ3K7DJ5YkBrT Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0vJc0ACgkQs8o7QhFz NAWOhBAAj0vMrLoLHaI5pyM+aZrkuTF5WFH8qBZZEG7suaUOovi93w/8pbwgfnk6 sTD8BFlu/zqalF0Pyl3aA78g37YjA00d0zOI0dUYcBOY9q0Mkzfsw/tgx+w/fovv 7dSgIsq1XovItkkErOdIx1JbNLQ/a5wf8w0ej2V4tBk6LT57jxkgadk4dHnTXnuX +ulEzQR0UzU7rQc6DNIUVDPyCSp7IpJK6bWIXDVMaDq3H89Jp/l4SEdw6T+3t2cz UY8Y8dkSsGcCEfZHttO+10/BpQhjusK/DNiFLO45VwVJrxMgRMjEQiWW4n792FRm 3ROFRW7Z5We4oBsnnv0HDRTJvTOQOFvp5gTLtieU4WhYM3OnSk+1I/NUOqocjIGs FKyXGfOlISaHxRpqmbEuKyFT9hzM3WNjQtVbv0fnmAKaPFC9uFgBAfnz141gOeXJ tqY5xhL06EpXW5qVJWOr0oQVXd/L9AKBzl9ahsFomtm9SLVyry5xa06rxHUVx+gv 1MonGbkZqZvO66QZp2DHeOkpMUiesqkOWSZfSbRZ+ackGDxQlgCuBIU2qijy9df7 ZW23rUtoDhFpW8p4nLg8cs7sXWF2hprZN7Vf57pohk358JZGzikN60mQ3IZ0d2je RRfVFDGb89g3NEWAbN6SilkA/F+qhOC6fN5tNd0rJNj/NJ4XOWE= =4XMJ -----END PGP SIGNATURE----- --X1bOJ3K7DJ5YkBrT-- From owner-freebsd-questions@freebsd.org Wed Jul 17 14:49:10 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DA48BAE38C for ; Wed, 17 Jul 2019 14:49:10 +0000 (UTC) (envelope-from btv1==1019b45fcd4==bcantrall@barracuda.com) Received: from esg-mdw.barracuda.com (esg-scl.cuda-inc.com [64.235.144.189]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Barracuda/emailAddress=sales@barracuda.com", Issuer "Barracuda/emailAddress=sales@barracuda.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 1299A8482D for ; Wed, 17 Jul 2019 14:49:08 +0000 (UTC) (envelope-from btv1==1019b45fcd4==bcantrall@barracuda.com) X-ASG-Debug-ID: 1563374934-0e7bdd50bd2a0e40001-jLrpzn Received: from IP-MDW-EXCH03.ad.cuda-inc.com (ip-mdw-exch03.cuda-inc.com [10.16.96.23]) by esg-mdw.barracuda.com with ESMTP id gU9YUK6T5qJbLuQc (version=TLSv1.2 cipher=ECDHE-RSA-AES256-SHA384 bits=256 verify=NO) for ; Wed, 17 Jul 2019 07:48:54 -0700 (PDT) X-Barracuda-Envelope-From: bcantrall@barracuda.com Received: from IP-MDW-EXCH03.ad.cuda-inc.com (10.16.96.23) by IP-MDW-EXCH03.ad.cuda-inc.com (10.16.96.23) with Microsoft SMTP Server (TLS) id 15.0.1367.3; Wed, 17 Jul 2019 09:48:53 -0500 Received: from NAM02-CY1-obe.outbound.protection.outlook.com (104.47.37.51) by IP-MDW-EXCH03.ad.cuda-inc.com (10.16.96.23) with Microsoft SMTP Server (TLS) id 15.0.1367.3 via Frontend Transport; Wed, 17 Jul 2019 09:48:53 -0500 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=hpMNYW4RH9o6cSyTeGNmcGFZKYVVzWUE0avYOiAvSsWKWmICb1uAqx2PcK5h30UKiTgVeWy9x6wvYMzFagcbl7HUhjK9Et9M7MlrNWqtiU8DsKZ+2v8V0J2Ot4xf4zdAhLfV2Jjkq67B1moVM0FB5hRC2bwuMNPg3hVfJ/FH/44zRTKC0MvxgiA6biVbGHj6mVpitoB+9Pj0y3oNCwltQZvF2mICGnKfv1eTx34ttXfH+WfOJRdcHDnACXVglR+ra2HWyT6wPCnTfDwunKm4VHxcbp3lzkLA/rlD4SdMO7F/sYtGtpLT56ZyFNd9EMFr6qNaBHVl5kDdkQoEk2aK0g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=wQVyhWGex8QDGTBpen5XmA2LIxqyDPdrtdFo8S7QmVw=; b=KjEgyF7aw2zwlaxecU9cuRnvZpVj7kqK2R5vsKc47elyNNwAvjebdD1dfI82XoNvWvYTTt2EmuG4p5g4w9j0aEgf/L+NthR5BRxBJIsmaRsh0Xp6sRhAkBZX6V5nw46JgxAExCZmm1TVSLDBIlr/ydp7m5cyVZa8bMKzrB1OxZ2y8tG/oWP9z/MR0813fZw5rMUMarH1AlF1/X5FxHkVojgEthJzbgn0ir2pxj2oNPFhzwhjTkcE6n7oyJi97lzHVVyoB15MrPORmb2oS0Ud6s/ZINapJJvWrk4zWrfh+P0Ke2Eqd5lbI+1f4CIqGyQqRy0S8YWzebgheEDN0HcrGw== ARC-Authentication-Results: i=1; mx.microsoft.com 1;spf=pass smtp.mailfrom=barracuda.com;dmarc=pass action=none header.from=barracuda.com;dkim=pass header.d=barracuda.com;arc=none Received: from DM5PR10MB1452.namprd10.prod.outlook.com (10.168.104.10) by DM5PR10MB1771.namprd10.prod.outlook.com (10.172.36.10) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2094.11; Wed, 17 Jul 2019 14:48:51 +0000 Received: from DM5PR10MB1452.namprd10.prod.outlook.com ([fe80::8539:7dac:ebb7:e414]) by DM5PR10MB1452.namprd10.prod.outlook.com ([fe80::8539:7dac:ebb7:e414%7]) with mapi id 15.20.2073.012; Wed, 17 Jul 2019 14:48:51 +0000 From: Bruce Cantrall To: "freebsd-questions@freebsd.org" Subject: how to upgrade mysql56-server to mysql57-server? Thread-Topic: how to upgrade mysql56-server to mysql57-server? X-ASG-Orig-Subj: how to upgrade mysql56-server to mysql57-server? Thread-Index: AQHVPK6//trHSOHC0UiBpCTaZxBfsA== Date: Wed, 17 Jul 2019 14:48:51 +0000 Message-ID: <2AE8B6FE-CA25-4460-8629-B289BCB0BDFC@contoso.com> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: user-agent: Microsoft-MacOutlook/10.1b.0.190715 x-originating-ip: [207.67.44.178] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 1cddeb87-3f46-4f4e-a625-08d70ac5e24b x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600148)(711020)(4605104)(1401327)(2017052603328)(7193020); SRVR:DM5PR10MB1771; x-ms-traffictypediagnostic: DM5PR10MB1771: x-ms-exchange-purlcount: 2 x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:9508; x-forefront-prvs: 01018CB5B3 x-forefront-antispam-report: SFV:NSPM; SFS:(10019020)(39860400002)(396003)(366004)(346002)(136003)(376002)(199004)(189003)(71200400001)(71190400001)(2906002)(68736007)(2501003)(86362001)(25786009)(8676002)(316002)(58126008)(64756008)(14454004)(66946007)(256004)(66446008)(76116006)(66476007)(486006)(14444005)(5660300002)(36756003)(102836004)(236005)(6512007)(9686003)(66556008)(53936002)(6506007)(6436002)(66066001)(5640700003)(99286004)(186003)(26005)(6916009)(2351001)(7736002)(6486002)(476003)(81166006)(33656002)(3846002)(478600001)(81156014)(8936002)(6306002)(6116002)(54896002); DIR:OUT; SFP:1102; SCL:1; SRVR:DM5PR10MB1771; H:DM5PR10MB1452.namprd10.prod.outlook.com; FPR:; SPF:None; LANG:en; PTR:InfoNoRecords; A:1; MX:1; received-spf: None (protection.outlook.com: barracuda.com does not designate permitted sender hosts) x-ms-exchange-senderadcheck: 1 x-microsoft-antispam-message-info: hDXUHRlzuhGPJUVyP6R34+onXrzTmhHxu0wx0cIFyRpGJ/+1RVR0ThIkJJjIcthPpLwWyLm+Nc8fBGyXQyQK0lsblxvT0JQJyaobZ72JEd08BMWDvqJCHbgVy2OOLQ6G7fckiCxSFLJXTgJxxf8okzHLQriBjQ6oKIqti3acymCLf0JJr1qJtIG4MrXlTYVCg4RdeWkynbl3kzIdJK1A1MgZSlv1yzpZ2g+kSAWJZpTP5upAxAa4ft5E0KlOjKGZHMBuY7vGXszFOPQnAEdPVybUoqjgYEcoKkfFFMGyO+8ZsdoYkqwy3K14QVQlpXJlqcwxKHsdvh37teganDWnlGI+K/CaLupUFnul9pmXbLzwqBQmVWOeh1PlUXASPHTCkm13XuKsGcuLIKj7fzmUiamec0GAQBkyugEPbntE5o8= MIME-Version: 1.0 X-MS-Exchange-CrossTenant-Network-Message-Id: 1cddeb87-3f46-4f4e-a625-08d70ac5e24b X-MS-Exchange-CrossTenant-originalarrivaltime: 17 Jul 2019 14:48:51.6076 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: b893e0b8-2743-4fa7-81eb-0155a9060350 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: bcantrall@barracuda.com X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM5PR10MB1771 X-OriginatorOrg: barracuda.com X-Barracuda-Connect: ip-mdw-exch03.cuda-inc.com[10.16.96.23] X-Barracuda-Start-Time: 1563374934 X-Barracuda-Encrypted: ECDHE-RSA-AES256-SHA384 X-Barracuda-URL: https://esg-scl.cuda-inc.com:443/cgi-mod/mark.cgi X-Barracuda-BRTS-Status: 1 X-Virus-Scanned: by bsmtpd at barracuda.com X-Barracuda-Scan-Msg-Size: 9655 X-Barracuda-Spam-Score: 0.02 X-Barracuda-Spam-Status: No, SCORE=0.02 using per-user scores of TAG_LEVEL=1000.0 QUARANTINE_LEVEL=1000.0 KILL_LEVEL=7.0 tests=HTML_MESSAGE, THREAD_INDEX, THREAD_TOPIC X-Barracuda-Spam-Report: Code version 3.2, rules version 3.2.3.74078 Rule breakdown below pts rule name description ---- ---------------------- -------------------------------------------------- 0.01 THREAD_INDEX thread-index: AcO7Y8iR61tzADqsRmmc5wNiFHEOig== 0.01 THREAD_TOPIC Thread-Topic: ...(Japanese Subject)... 0.00 HTML_MESSAGE BODY: HTML included in message X-Rspamd-Queue-Id: 1299A8482D X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dmarc=pass (policy=none) header.from=barracuda.com; spf=pass (mx1.freebsd.org: domain of btv1==1019b45fcd4==bcantrall@barracuda.com designates 64.235.144.189 as permitted sender) smtp.mailfrom=btv1==1019b45fcd4==bcantrall@barracuda.com X-Spamd-Result: default: False [0.14 / 15.00]; HAS_XOIP(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:64.235.144.0/20]; ENVFROM_PRVS(0.00)[]; ARC_REJECT(2.00)[signature check failed: fail, {[1] = sig:microsoft.com:reject}]; RCVD_IN_DNSWL_MED(-0.20)[189.144.235.64.list.dnswl.org : 127.0.3.2]; MX_GOOD(-0.01)[d160221b.ess.barracudanetworks.com,d160221a.ess.barracudanetworks.com,esg-scl.cuda-inc.com,esg-mdw.cuda-inc.com]; MIME_BASE64_TEXT(0.10)[]; NEURAL_HAM_SHORT(-0.24)[-0.236,0]; DMARC_POLICY_ALLOW(-0.50)[barracuda.com,none]; FORGED_SENDER(0.00)[bcantrall@barracuda.com,btv1==1019b45fcd4==bcantrall@barracuda.com]; MIME_TRACE(0.00)[0:+,1:+]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:15324, ipnet:64.235.144.0/20, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[bcantrall@barracuda.com,btv1==1019b45fcd4==bcantrall@barracuda.com]; RCVD_TLS_LAST(0.00)[]; NEURAL_HAM_MEDIUM(-0.97)[-0.973,0]; RCVD_COUNT_FIVE(0.00)[6]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.73)[-0.728,0]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; FORGED_SENDER_VERP_SRS(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-0.01)[country: US(-0.05)]; TO_DN_EQ_ADDR_ALL(0.00)[] Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 14:49:10 -0000 RGF0ZTogV2VkLCAxNyBKdWwgMjAxOSAwNTowNjo1MCArMDEwMA0KRnJvbTog dGVjaC1saXN0cyA8dGVjaC1saXN0c0B6eXhzdC5uZXQ8bWFpbHRvOnRlY2gt bGlzdHNAenl4c3QubmV0Pj4NCj5UaGUgZGVmYXVsdCB2ZXJzaW9uIG9mIG15 c3FsL215c3FsZCBjaGFuZ2VkIGZyb20gNS42IHRvIDUuNyBvbiAyMDE5MDcw MS4NCj5UaGUgcHJvYmxlbSBub3cgaXMgdGhhdCBpZiAicGtnIHVwZ3JhZGUi IGlzIHJ1biwgbXlzcWwtY2xpZW50IGlzDQo+dXBncmFkZWQgYW5kIHRoZSBl eGlzdGluZyBteXNxbCg1Niktc2VydmVyIGlzICpyZW1vdmVkKi4NCj5teXNx bDU3LXNlcnZlciBpcyBub3QgaW5zdGFsbGVkLg0KDQpXZSBoYWQgYW4gaXNz dWUgd2l0aCBhIG1peGVkIGNhc2UgZGF0YWJhc2UgdGhhdCBjYXVzZWQgdXMg dG8gZG8gc29tZSBtb3JlIHN0ZXBzIGJlY2F1c2Ugd2UgZ290IG90aGVyIGVy cm9ycyB3aGVuIHN0YXJ0aW5nIG15c3FsLXNlcnZlci4gICBUaGlzIGlzIHdo YXQgd29ya2VkIGZvciBteSBGcmVlQlNEIDExLjItUkVMRUFTRS1wMTEgYm94 Lg0KDQogIDEuICBSZS1pbnN0YWxsIG15c3FsLXNlcnZlcjUuNyBhZnRlciB1 bmluc3RhbGxlZCBieSBtb29kbGUNCiAgICAgKiAgIHBrZyAgaW5zdGFsbCBt eXNxbDU3LXNlcnZlcg0KICAyLiAgVmVyaWZ5IHRoZXJlIGlzIGEgbXkuY25m IGZpbGUgaW4gL3Vzci9sb2NhbC9ldGMvDQogIDMuICBSZW1vdmUgdGhlIG5l dyBvbmUgaW4gL3Vzci9sb2NhbC9ldGMvbXlzcWwvbXkuY25mDQogIDQuICBB ZGQgdGhlIGZvbGxvd2luZyBsaW5lIHRvIHRoZSBib3R0b20gb2YgL3Vzci9s b2NhbC9ldGMvbXkuY25mDQogICAgICogICBsb3dlcl9jYXNlX3RhYmxlX25h bWVzID0gMA0KICA1LiAgQ29tbWVudCBvdXQgYW55IG15SVNBTSBsaW5lcw0K DQogICAgICogICAja2V5LWJ1ZmZlci1zaXplICAgICAgICAgICAgICAgID0g MzJNDQogICAgICogICAjbXlpc2FtLXJlY292ZXIgICAgICAgICAgICAgICAg ID0gRk9SQ0UsQkFDS1VQDQogIDEuICBTdGFydCBteXNxbCBzZXJ2ZXINCg0K ICAgICAqICAgc2VydmljZSBteXNxbC1zZXJ2ZXIgc3RhcnQNCiAgMS4gIFRh aWwgbG9nIGZpbGUgL3Zhci9kYi9teXNxbC8NCg0KICAgICAqICAgL3Zhci9k Yi9teXNxbC9kYXRhbG9nbHAxL215c3FsLWVycm9yLmxvZw0KICAxLiAgUnVu IG15c3FsX3VwZ3JhZGUNCg0KICAgICAqICAgbXlzcWxfdXBncmFkZSAtdXJv b3QgLXANCiAgICAgKiAgIFNob3VsZCBjb21wbGV0ZSB3aXRob3V0IGVycm9y cy4NCiAgMS4gIFJlc3RhcnQgbXlzcWwgc2VydmVyDQoNCiAgICAgKiAgIHNl cnZpY2UgbXlzcWwtc2VydmVyIHJlc3RhcnQNCg0KDQpDYW4gYW55b25lIGVs c2UgY29uZmlybSB0aGF0IHRoZXkgc2VlbiBteS5jbmYgaW4gbXVsdGlwbGUg ZGlyZWN0b3JpZXM/DQpCcnVjZSBDDQoNCgo9PT09PT09PT09PT09PT09PT09 PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09PQ0KRm9y cmVzdGVyIG5hbWVzIEJhcnJhY3VkYSBXQUYgYSBTdHJvbmcgUGVyZm9ybWVy IQ0KR2V0IHRoZSBmcmVlIHJlcG9ydCBoZXJlIQ0KaHR0cHM6Ly93d3cuYmFy cmFjdWRhLmNvbS9XQUZXYXZlDQoNCkRJU0NMQUlNRVI6DQpUaGlzIGUtbWFp bCBhbmQgYW55IGF0dGFjaG1lbnRzIHRvIGl0IGNvbnRhaW4gY29uZmlkZW50 aWFsIGFuZCBwcm9wcmlldGFyeSBtYXRlcmlhbCBvZiBCYXJyYWN1ZGEsIGl0 cyBhZmZpbGlhdGVzIG9yIGFnZW50cywgYW5kIGlzIHNvbGVseSBmb3IgdGhl IHVzZSBvZiB0aGUgaW50ZW5kZWQgcmVjaXBpZW50LiBBbnkgcmV2aWV3LCB1 c2UsIGRpc2Nsb3N1cmUsIGRpc3RyaWJ1dGlvbiBvciBjb3B5aW5nIG9mIHRo aXMgdHJhbnNtaXR0YWwgaXMgcHJvaGliaXRlZCBleGNlcHQgYnkgb3Igb24g YmVoYWxmIG9mIHRoZSBpbnRlbmRlZCByZWNpcGllbnQuIElmIHlvdSBoYXZl IHJlY2VpdmVkIHRoaXMgdHJhbnNtaXR0YWwgaW4gZXJyb3IsIHBsZWFzZSBu b3RpZnkgdGhlIHNlbmRlciBhbmQgZGVzdHJveSB0aGlzIGUtbWFpbCBhbmQg YW55IGF0dGFjaG1lbnRzIGFuZCBhbGwgY29waWVzLCB3aGV0aGVyIGVsZWN0 cm9uaWMgb3IgcHJpbnRlZC4NCj09PT09PT09PT09PT09PT09PT09PT09PT09 PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09PT09Cg== From owner-freebsd-questions@freebsd.org Wed Jul 17 15:37:29 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D4A09AF10F for ; Wed, 17 Jul 2019 15:37:29 +0000 (UTC) (envelope-from pathiaki2@yahoo.com) Received: from sonic311-24.consmr.mail.ne1.yahoo.com (sonic311-24.consmr.mail.ne1.yahoo.com [66.163.188.205]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 5ABEF86945 for ; Wed, 17 Jul 2019 15:37:28 +0000 (UTC) (envelope-from pathiaki2@yahoo.com) X-YMail-OSG: SerobB4VM1mVamJXVJrOflImdlWdzmbWRWoVnxGBNmArDb_EGAmXyIcmBQ0V8aP 3TJPx8fqLO9RFudd0165kWC5i8YCwRQ_le3qv4MESywtFsnhuk.MQGOduMc9DVx6KeDnhAArPnSA XF8ebaO6YLZ_Zcp4gyQ3YZeZ.AUHQnJyBrddFWBo27a09mnS4E6Gy8UVLKhOzy2oVadF3c_GhuzE cR6zfS3zOH.FtrgQVKYQXvRkNth2waKSatWAYFot7e6mifi24i_dLhJ_aW6KsqjsWm7yXlfrHHRB FNwnsChZ6du9Zn_EATQwlRxW4kPJTRHvVkg.V_PnBECyO9dO5Aa86.q0gCO2gJxv1L4BtYTL00ay aXU6TA09ER2mXIQ1Iez9hw0xQMjAZCFZEvL_zX5R5ekW6UIbbeOrAwSlUrGSrHqlghGWgXE9VwTu JvTAhc6gj_h7ZE.5UT0_4XjnZYjYCIi4EmMT6RsE7PJZHDzZ1KrlZNFAbzsuGE_yIm0i9LpuCSPL OuSDNaQtRKgmHsMJnLWAqAKz3zi_7YKlrnGvXIyFRUOXA6hfqm0n5f0E0yJmaa09qSGAVEh9Lb8a oj26KbYr0JiMroJ.OAqYdoDnGSLB8DJAAtrE1uC41JSmAlXg79IOr7CNcNAJrZsFsJclEELJ7CiJ MGDTRi88smMmBEBxroTfBXo59jbWM38_JHUtLB.nYxcwicmX2pSrWMLafe8qw2RxP7Lz8KkwUSfq Mdk0Rq8gTe.nKHzu7sQCbrhllZ45iaBdClvskSIgAe2hXv322xyGOpZ8ANjpZEF2yXphq7HbTg0A qOaqAkB821yMFHuSU5sQuFr9GvCUYSoQDLUKMsH2nRLjqujzVJ139_ilACNx8Va.FNlcMwsgt1Fm 8mHOXMZLdBAPZqsDEnYhiVNzUWHRxpEpYhbc5O1mId_jTLE7xt1EZu1ZKi1kHJx1X8kqLO9JxMHz qKqOIC4zXd6mLAYoM6DKdKFfzAa6yIH_AiREkZcj.aehq7bx16FHag3DF7HK5pxxRKAjFWy4msFh ccER0d2GE11bC8c5fSg12pjhci5jPuumtfzO8r_NxLr87YhXhCBKgAZDmhfQrHDUD3Ygqi.LL_tg NyaOrs7nqJw6kJjsJNCwnCFhTlrZXRfhUorVn7EDf5f9fsmMw0BQxZeia6HQ6S6eg.AlnnD_eYBp eJkyGUg9CsLFGnx6Cs.2mUwboXMm2p7AMkUexwnm3fUzGctEFnJGuAwrBJhnEFOQXDgL0y10SaeE - Received: from sonic.gate.mail.ne1.yahoo.com by sonic311.consmr.mail.ne1.yahoo.com with HTTP; Wed, 17 Jul 2019 15:37:26 +0000 Date: Wed, 17 Jul 2019 15:37:21 +0000 (UTC) From: Paul Pathiakis To: FreeBSD Questions Message-ID: <1738488191.3299552.1563377841693@mail.yahoo.com> Subject: Dell EMC Boss on R7425 MIME-Version: 1.0 References: <1738488191.3299552.1563377841693.ref@mail.yahoo.com> X-Mailer: WebService/1.1.13991 YMailNorrin Mozilla/5.0 (Windows NT 6.1; WOW64; rv:60.0) Gecko/20100101 Firefox/60.0 X-Rspamd-Queue-Id: 5ABEF86945 X-Spamd-Bar: +++ X-Spamd-Result: default: False [3.36 / 15.00]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; FREEMAIL_FROM(0.00)[yahoo.com]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_SPAM_SHORT(0.96)[0.963,0]; NEURAL_SPAM_MEDIUM(0.99)[0.994,0]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_LAST(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; MX_GOOD(-0.01)[cached: mta6.am0.yahoodns.net]; RCVD_IN_DNSWL_NONE(0.00)[205.188.163.66.list.dnswl.org : 127.0.5.0]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; IP_SCORE(1.45)[ip: (5.03), ipnet: 66.163.184.0/21(1.28), asn: 36646(1.02), country: US(-0.05)]; NEURAL_SPAM_LONG(0.96)[0.958,0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36646, ipnet:66.163.184.0/21, country:US]; RCVD_COUNT_TWO(0.00)[2]; DWL_DNSWL_NONE(0.00)[yahoo.com.dwl.dnswl.org : 127.0.5.0] X-Mailman-Approved-At: Wed, 17 Jul 2019 16:08:08 +0000 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 15:37:29 -0000 Hi all, I'm trying to see the NVME m.2 drives that are on a Dell R7425.=C2=A0 The U= EFI/BIOS sees the controller and the M.2 drives on it. I'm on FreeNAS running 11.3 of FreeBSD. I don't see the controller in dmesg, pciconf, or camcontrol.=C2=A0 :( Does anyone know what the issue is? Is there no driver?=C2=A0 I read the fo= rums and it seems that this was addressed back in 2017.=C2=A0 Regression?= =C2=A0 Nothing in pciconf jumps out at me as being a disk controller.... (p= lease point it out if you see it....)=C2=A0 Any other tools I can use to fi= nd this thing? camcontrol devlist root@freenas[~]# camcontrol devlist =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 0 lun 0 (pass0,da0) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 1 lun 0 (pass1,da1) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 2 lun 0 (pass2,da2) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 3 lun 0 (pass3,da3) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 4 lun 0 (pass4,da4) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 5 lun 0 (pass5,da5) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 6 lun 0 (pass6,da6) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 at sc= bus2 target 7 lun 0 (pass7,da7) =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2= =A0=C2=A0=C2=A0=C2=A0 at scbus5 target 0 lun 0 (pass8) # pciconf -lv hostb0@pci0:0:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 07f91028 chip=3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none0@pci0:0:0:2:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x080600 card= =3D0x07f91028 chip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb1@pci0:0:1:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib1@pci0:0:1:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x07f91028 chip=3D0x14531022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) PCIe GPP Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI pcib2@pci0:0:1:3:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x07f91028 chip=3D0x14531022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) PCIe GPP Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI pcib4@pci0:0:1:4:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x07f91028 chip=3D0x14531022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) PCIe GPP Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb2@pci0:0:2:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb3@pci0:0:3:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb4@pci0:0:4:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb5@pci0:0:7:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib5@pci0:0:7:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x07f91028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb6@pci0:0:8:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x= 00000000 chip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib6@pci0:0:8:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x07f91028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none1@pci0:0:20:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x0c0500 card=3D0x= 07f91028 chip=3D0x790b1022 rev=3D0x59 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'FCH SMBus Controller= ' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D serial bus =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D SMBus isab0@pci0:0:20:3:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060100 card=3D0x= 07f91028 chip=3D0x790e1022 rev=3D0x51 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'FCH LPC Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-ISA hostb7@pci0:0:24:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000= 000 chip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb8@pci0:0:24:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000= 000 chip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb9@pci0:0:24:2:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000= 000 chip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb10@pci0:0:24:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb11@pci0:0:24:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb12@pci0:0:24:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb13@pci0:0:24:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb14@pci0:0:24:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb15@pci0:0:25:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb16@pci0:0:25:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb17@pci0:0:25:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb18@pci0:0:25:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb19@pci0:0:25:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb20@pci0:0:25:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb21@pci0:0:25:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb22@pci0:0:25:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb23@pci0:0:26:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb24@pci0:0:26:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb25@pci0:0:26:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb26@pci0:0:26:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb27@pci0:0:26:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb28@pci0:0:26:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb29@pci0:0:26:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb30@pci0:0:26:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb31@pci0:0:27:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb32@pci0:0:27:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb33@pci0:0:27:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb34@pci0:0:27:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb35@pci0:0:27:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb36@pci0:0:27:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb37@pci0:0:27:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb38@pci0:0:27:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb39@pci0:0:28:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb40@pci0:0:28:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb41@pci0:0:28:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb42@pci0:0:28:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb43@pci0:0:28:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb44@pci0:0:28:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb45@pci0:0:28:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb46@pci0:0:28:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb47@pci0:0:29:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb48@pci0:0:29:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb49@pci0:0:29:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb50@pci0:0:29:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb51@pci0:0:29:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb52@pci0:0:29:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb53@pci0:0:29:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb54@pci0:0:29:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb55@pci0:0:30:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb56@pci0:0:30:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb57@pci0:0:30:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb58@pci0:0:30:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb59@pci0:0:30:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb60@pci0:0:30:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb61@pci0:0:30:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb62@pci0:0:30:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb63@pci0:0:31:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14601022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 0' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb64@pci0:0:31:1:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14611022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 1' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb65@pci0:0:31:2:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14621022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 2' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb66@pci0:0:31:3:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14631022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 3' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb67@pci0:0:31:4:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14641022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 4' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb68@pci0:0:31:5:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14651022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 5' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb69@pci0:0:31:6:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14661022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 6' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb70@pci0:0:31:7:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14671022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Data Fabric: Device 18h; Function 7' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI ixl0@pci0:1:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x020000= card=3D0x1f991028 chip=3D0x15728086 rev=3D0x02 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Intel Corporation' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Ethernet Controller = X710 for 10GbE SFP+' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D network =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D ethernet ixl1@pci0:1:0:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x020000= card=3D0x00001028 chip=3D0x15728086 rev=3D0x02 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Intel Corporation' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Ethernet Controller = X710 for 10GbE SFP+' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D network =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D ethernet pcib3@pci0:2:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card= =3D0x00000000 chip=3D0xbe001556 rev=3D0x02 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'PLDA' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI vgapci0@pci0:3:0:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x030000 card=3D0x00000= 000 chip=3D0x0536102b rev=3D0x04 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Matrox Electronics S= ystems Ltd.' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Integrated Matrox G2= 00eW3 Graphics Controller' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D display =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D VGA igb0@pci0:4:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x020000= card=3D0x1f9a1028 chip=3D0x15218086 rev=3D0x01 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Intel Corporation' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'I350 Gigabit Network= Connection' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D network =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D ethernet igb1@pci0:4:0:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x020000= card=3D0x1f9a1028 chip=3D0x15218086 rev=3D0x01 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Intel Corporation' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'I350 Gigabit Network= Connection' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D network =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D ethernet none2@pci0:5:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card= =3D0x07f91028 chip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none3@pci0:5:0:2:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card= =3D0x07f91028 chip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt xhci0@pci0:5:0:3:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x0c0330 card= =3D0x07f91028 chip=3D0x145f1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin USB 3.0 Hos= t controller' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D serial bus =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D USB none4@pci0:6:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card= =3D0x07f91028 chip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none5@pci0:6:0:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card= =3D0x07f91028 chip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt ahci0@pci0:6:0:2:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x010601 card= =3D0x07f91028 chip=3D0x79011022 rev=3D0x51 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'FCH SATA Controller = [AHCI mode]' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D mass storage =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D SATA hostb71@pci0:32:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x07f91028 c= hip=3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none6@pci0:32:0:2:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x= 07f91028 chip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb72@pci0:32:1:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb73@pci0:32:2:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb74@pci0:32:3:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb75@pci0:32:4:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb76@pci0:32:7:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib8@pci0:32:7:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x= 07f91028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb77@pci0:32:8:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib9@pci0:32:8:1:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x= 07f91028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none7@pci0:33:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x= 07f91028 chip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none8@pci0:33:0:2:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x= 07f91028 chip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt xhci1@pci0:33:0:3:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x0c0330 card=3D0x= 145c1022 chip=3D0x145f1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin USB 3.0 Hos= t controller' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D serial bus =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D USB none9@pci0:34:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x= 07f91028 chip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none10@pci0:34:0:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91= 028 chip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb78@pci0:64:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x07f91028 c= hip=3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none11@pci0:64:0:2:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91= 028 chip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb79@pci0:64:1:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb80@pci0:64:2:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb81@pci0:64:3:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb82@pci0:64:4:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb83@pci0:64:7:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib11@pci0:64:7:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb84@pci0:64:8:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib12@pci0:64:8:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none12@pci0:65:0:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91= 028 chip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none13@pci0:65:0:2:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91= 028 chip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none14@pci0:66:0:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91= 028 chip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none15@pci0:66:0:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91= 028 chip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb85@pci0:96:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x07f91028 c= hip=3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none16@pci0:96:0:2:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91= 028 chip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb86@pci0:96:1:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb87@pci0:96:2:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb88@pci0:96:3:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib14@pci0:96:3:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14531022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) PCIe GPP Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI pcib15@pci0:96:3:3:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14531022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) PCIe GPP Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb89@pci0:96:4:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb90@pci0:96:7:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib16@pci0:96:7:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb91@pci0:96:8:0:=C2=A0=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 c= hip=3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib17@pci0:96:8:1:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91= 028 chip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI mrsas0@pci0:97:0:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x010400 card=3D0x1f441= 028 chip=3D0x005f1000 rev=3D0x02 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Broadcom / LSI' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'MegaRAID SAS-3 3008 = [Fury]' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D mass storage =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D RAID ahci1@pci0:98:0:0:=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x010601 card=3D0x= 1fe21028 chip=3D0x92301b4b rev=3D0x11 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Marvell Technology G= roup Ltd.' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D '88SE9230 PCIe SATA 6= Gb/s Controller' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D mass storage =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D SATA none17@pci0:99:0:0:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91= 028 chip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none18@pci0:99:0:2:=C2=A0=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91= 028 chip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none19@pci0:100:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none20@pci0:100:0:1:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb92@pci0:128:0:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x07f91028 chip= =3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none21@pci0:128:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91028 c= hip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb93@pci0:128:1:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb94@pci0:128:2:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb95@pci0:128:3:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb96@pci0:128:4:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb97@pci0:128:7:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib19@pci0:128:7:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb98@pci0:128:8:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x00000000 chip= =3D0x14521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib20@pci0:128:8:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none22@pci0:129:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none23@pci0:129:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none24@pci0:130:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none25@pci0:130:0:1:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb99@pci0:160:0:0:=C2=A0=C2=A0 class=3D0x060000 card=3D0x07f91028 chip= =3D0x14501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none26@pci0:160:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91028 c= hip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb100@pci0:160:1:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb101@pci0:160:2:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb102@pci0:160:3:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb103@pci0:160:4:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb104@pci0:160:7:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib22@pci0:160:7:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb105@pci0:160:8:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib23@pci0:160:8:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none27@pci0:161:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none28@pci0:161:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none29@pci0:162:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none30@pci0:162:0:1:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb106@pci0:192:0:0:=C2=A0 class=3D0x060000 card=3D0x07f91028 chip=3D0x14= 501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none31@pci0:192:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91028 c= hip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb107@pci0:192:1:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb108@pci0:192:2:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb109@pci0:192:3:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb110@pci0:192:4:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb111@pci0:192:7:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib25@pci0:192:7:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb112@pci0:192:8:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib26@pci0:192:8:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none32@pci0:193:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none33@pci0:193:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none34@pci0:194:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none35@pci0:194:0:1:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt hostb113@pci0:224:0:0:=C2=A0 class=3D0x060000 card=3D0x07f91028 chip=3D0x14= 501022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Root Complex' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI none36@pci0:224:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x080600 card=3D0x07f91028 c= hip=3D0x14511022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) I/O Memory Management Unit' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D base peripheral =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D IOMMU hostb114@pci0:224:1:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb115@pci0:224:2:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb116@pci0:224:3:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb117@pci0:224:4:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI hostb118@pci0:224:7:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib28@pci0:224:7:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI hostb119@pci0:224:8:0:=C2=A0 class=3D0x060000 card=3D0x00000000 chip=3D0x14= 521022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-1fh) PCIe Dummy Host Bridge' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D HOST-PCI pcib29@pci0:224:8:1:=C2=A0=C2=A0=C2=A0 class=3D0x060400 card=3D0x07f91028 c= hip=3D0x14541022 rev=3D0x00 hdr=3D0x01 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Internal PCIe GPP Bridge 0 to Bus B' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D bridge =C2=A0=C2=A0=C2=A0 subclass=C2=A0=C2=A0 =3D PCI-PCI none37@pci0:225:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x145a1022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Raven/Raven= 2 PCIe Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none38@pci0:225:0:2:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14561022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Family 17h (Models 0= 0h-0fh) Platform Security Processor' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt none39@pci0:226:0:0:=C2=A0=C2=A0=C2=A0 class=3D0x130000 card=3D0x07f91028 c= hip=3D0x14551022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin/Renoir PCIe= Dummy Function' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D non-essential in= strumentation none40@pci0:226:0:1:=C2=A0=C2=A0=C2=A0 class=3D0x108000 card=3D0x07f91028 c= hip=3D0x14681022 rev=3D0x00 hdr=3D0x00 =C2=A0=C2=A0=C2=A0 vendor=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Advanced Micro Devic= es, Inc. [AMD]' =C2=A0=C2=A0=C2=A0 device=C2=A0=C2=A0=C2=A0=C2=A0 =3D 'Zeppelin Cryptograph= ic Coprocessor NTBCCP' =C2=A0=C2=A0=C2=A0 class=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D encrypt/decrypt root@freenas[~]# root@freenas[~]# nvmecontrol usage: =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol devlist =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol identify [-x [-v]] =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol perftest <-n num_threads> = <-o read|write> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2= =A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0= =C2=A0=C2=A0 <-s size_in_bytes> <-t time_in_seconds> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2= =A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0= =C2=A0=C2=A0 <-i intr|wait> [-f refthread] [-p] =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2= =A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0= =C2=A0=C2=A0 =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol reset =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol logpage <-p page_id> [-b] = [-v vendor] [-x] =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol firmware [-s slot] [-f pat= h_to_firmware] [-a] =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol power [-l] [-p new-state [= -w workload-hint]] =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 nvmecontrol wdc (cap-diag|drive-log|ge= t-crash-dump|purge|purge-montior) root@freenas[~]# nvmecontrol devlist No NVMe controllers found. No controllers... :( root@freenas[~]# cat /var/run/dmesg.boot Copyright (c) 1992-2019 The FreeBSD Project. Copyright (c) 1979, 1980, 1983, 1986, 1988, 1989, 1991, 1992, 1993, 1994 =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 The Regents of the University of= California. All rights reserved. FreeBSD is a registered trademark of The FreeBSD Foundation. FreeBSD 11.3-RELEASE #0 1980c6856(freenas/11-stable): Wed Jul 17 06:47:47 U= TC 2019 =C2=A0=C2=A0=C2=A0 root@ip-172-31-34-94.us-east-2.compute.internal:/freenas= /freenas/_BE/objs/freenas/freenas/_BE/os/sys/FreeNAS.amd64 amd64 FreeBSD clang version 8.0.0 (tags/RELEASE_800/final 356365) (based on LLVM = 8.0.0) SRAT: No memory found for CPU 0 VT(efifb): resolution 1024x768 CPU: AMD EPYC 7551 32-Core Processor=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2= =A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 (1996.30-MHz K8-c= lass CPU) =C2=A0 Origin=3D"AuthenticAMD"=C2=A0 Id=3D0x800f12=C2=A0 Family=3D0x17=C2= =A0 Model=3D0x1=C2=A0 Stepping=3D2 =C2=A0 Features=3D0x178bfbff =C2=A0 Features2=3D0x7ed8320b =C2=A0 AMD Features=3D0x2e500800 =C2=A0 AMD Features2=3D0x35c233ff =C2=A0 Structured Extended Features=3D0x209c01a9 =C2=A0 XSAVE Features=3D0xf =C2=A0 AMD Extended Feature Extensions ID EBX=3D0x1007 =C2=A0 SVM: NP,NRIP,VClean,AFlush,DAssist,NAsids=3D32768 =C2=A0 TSC: P-state invariant, performance statistics real memory=C2=A0 =3D 137434759168 (131068 MB) avail memory =3D 133111234560 (126944 MB) Event timer "LAPIC" quality 600 ACPI APIC Table: FreeBSD/SMP: Multiprocessor System Detected: 128 CPUs FreeBSD/SMP: 2 package(s) x 32 core(s) x 2 hardware threads WARNING: VIMAGE (virtualized network stack) is a highly experimental featur= e. ioapic0: Changing APIC ID to 128 ioapic1: Changing APIC ID to 129 ioapic2: Changing APIC ID to 130 ioapic3: Changing APIC ID to 131 ioapic4: Changing APIC ID to 132 ioapic5: Changing APIC ID to 133 ioapic6: Changing APIC ID to 134 ioapic7: Changing APIC ID to 135 ioapic8: Changing APIC ID to 136 ioapic0 irqs 0-23 on motherboard ioapic1 irqs 24-55 on motherboard ioapic2 irqs 56-87 on motherboard ioapic3 irqs 88-119 on motherboard ioapic4 irqs 120-151 on motherboard ioapic5 irqs 152-183 on motherboard ioapic6 irqs 184-215 on motherboard ioapic7 irqs 216-247 on motherboard ioapic8 irqs 248-279 on motherboard SMP: AP CPU #20 Launched! SMP: AP CPU #5 Launched! SMP: AP CPU #3 Launched! SMP: AP CPU #4 Launched! SMP: AP CPU #7 Launched! SMP: AP CPU #2 Launched! SMP: AP CPU #6 Launched! SMP: AP CPU #1 Launched! SMP: AP CPU #62 Launched! SMP: AP CPU #58 Launched! SMP: AP CPU #60 Launched! SMP: AP CPU #61 Launched! SMP: AP CPU #56 Launched! SMP: AP CPU #39 Launched! SMP: AP CPU #34 Launched! SMP: AP CPU #32 Launched! SMP: AP CPU #35 Launched! SMP: AP CPU #37 Launched! SMP: AP CPU #23 Launched! SMP: AP CPU #18 Launched! SMP: AP CPU #22 Launched! SMP: AP CPU #17 Launched! SMP: AP CPU #28 Launched! SMP: AP CPU #31 Launched! SMP: AP CPU #30 Launched! SMP: AP CPU #25 Launched! SMP: AP CPU #24 Launched! SMP: AP CPU #29 Launched! SMP: AP CPU #27 Launched! SMP: AP CPU #19 Launched! SMP: AP CPU #26 Launched! SMP: AP CPU #49 Launched! SMP: AP CPU #51 Launched! SMP: AP CPU #55 Launched! SMP: AP CPU #54 Launched! SMP: AP CPU #48 Launched! SMP: AP CPU #52 Launched! SMP: AP CPU #50 Launched! SMP: AP CPU #53 Launched! SMP: AP CPU #8 Launched! SMP: AP CPU #11 Launched! SMP: AP CPU #15 Launched! SMP: AP CPU #12 Launched! SMP: AP CPU #9 Launched! SMP: AP CPU #13 Launched! SMP: AP CPU #14 Launched! SMP: AP CPU #43 Launched! SMP: AP CPU #47 Launched! SMP: AP CPU #45 Launched! SMP: AP CPU #42 Launched! SMP: AP CPU #41 Launched! SMP: AP CPU #46 Launched! SMP: AP CPU #44 Launched! SMP: AP CPU #40 Launched! SMP: AP CPU #127 Launched! SMP: AP CPU #123 Launched! SMP: AP CPU #124 Launched! SMP: AP CPU #121 Launched! SMP: AP CPU #122 Launched! SMP: AP CPU #126 Launched! SMP: AP CPU #125 Launched! SMP: AP CPU #120 Launched! SMP: AP CPU #107 Launched! SMP: AP CPU #104 Launched! SMP: AP CPU #111 Launched! SMP: AP CPU #16 Launched! SMP: AP CPU #115 Launched! SMP: AP CPU #117 Launched! SMP: AP CPU #113 Launched! SMP: AP CPU #119 Launched! SMP: AP CPU #114 Launched! SMP: AP CPU #116 Launched! SMP: AP CPU #112 Launched! SMP: AP CPU #98 Launched! SMP: AP CPU #100 Launched! SMP: AP CPU #102 Launched! SMP: AP CPU #97 Launched! SMP: AP CPU #103 Launched! SMP: AP CPU #99 Launched! SMP: AP CPU #101 Launched! SMP: AP CPU #96 Launched! SMP: AP CPU #65 Launched! SMP: AP CPU #66 Launched! SMP: AP CPU #69 Launched! SMP: AP CPU #64 Launched! SMP: AP CPU #68 Launched! SMP: AP CPU #70 Launched! SMP: AP CPU #67 Launched! SMP: AP CPU #71 Launched! SMP: AP CPU #10 Launched! SMP: AP CPU #75 Launched! SMP: AP CPU #76 Launched! SMP: AP CPU #73 Launched! SMP: AP CPU #79 Launched! SMP: AP CPU #72 Launched! SMP: AP CPU #74 Launched! SMP: AP CPU #77 Launched! SMP: AP CPU #78 Launched! SMP: AP CPU #21 Launched! SMP: AP CPU #38 Launched! SMP: AP CPU #36 Launched! SMP: AP CPU #33 Launched! SMP: AP CPU #89 Launched! SMP: AP CPU #91 Launched! SMP: AP CPU #94 Launched! SMP: AP CPU #93 Launched! SMP: AP CPU #88 Launched! SMP: AP CPU #92 Launched! SMP: AP CPU #95 Launched! SMP: AP CPU #63 Launched! SMP: AP CPU #59 Launched! SMP: AP CPU #57 Launched! SMP: AP CPU #86 Launched! SMP: AP CPU #81 Launched! SMP: AP CPU #85 Launched! SMP: AP CPU #82 Launched! SMP: AP CPU #87 Launched! SMP: AP CPU #83 Launched! SMP: AP CPU #80 Launched! SMP: AP CPU #84 Launched! SMP: AP CPU #90 Launched! SMP: AP CPU #118 Launched! SMP: AP CPU #108 Launched! SMP: AP CPU #105 Launched! SMP: AP CPU #109 Launched! SMP: AP CPU #106 Launched! SMP: AP CPU #110 Launched! Timecounter "TSC" frequency 1996300480 Hz quality 800 random: entropy device external interface random: registering fast source Intel Secure Key RNG random: fast provider: "Intel Secure Key RNG" kbd0 at kbdmux0 mlx5en: Mellanox Ethernet driver 3.5.1 (April 2019) nexus0 cryptosoft0: on motherboard aesni0: on motherboard padlock0: No ACE support. acpi0: on motherboard acpi0: Power Button (fixed) hpet0: iomem 0xfed00000-0xfed001ff on acpi0 hpet0: memory region width 512 too small device_attach: hpet0 attach returned 6 attimer0: port 0x40-0x43 irq 0 on acpi0 Timecounter "i8254" frequency 1193182 Hz quality 0 Event timer "i8254" frequency 1193182 Hz quality 100 atrtc0: port 0x70-0x71 on acpi0 atrtc0: registered as a time-of-day clock, resolution 1.000000s Event timer "RTC" frequency 32768 Hz quality 0 Timecounter "ACPI-fast" frequency 3579545 Hz quality 900 acpi_timer0: <32-bit timer at 3.579545MHz> port 0x408-0x40b on acpi0 acpi_button0: on acpi0 pcib0: port 0xcf8-0xcff on acpi0 pci0: on pcib0 amdsmn0: on hostb0 amdtemp0: on hostb0 pci0: at device 0.2 (no driver attached) pcib1: at device 1.1 on pci0 pci1: on pcib1 ixl0: mem 0xed000000-0xedffffff,0xee008000-0xee00ffff at device 0.0 on pci1 ixl0: using 1024 tx descriptors and 1024 rx descriptors ixl0: fw 6.81.49447 api 1.7 nvm 6.80 etid 80003d71 oem 18.4608.9 ixl0: PF-ID[0]: VFs 64, MSIX 129, VF MSIX 5, QPs 768, I2C ixl0: Using MSIX interrupts with 9 vectors ixl0: Allocating 8 queues for PF LAN VSI; 8 queues active ixl0: Ethernet address: e4:43:4b:7c:f3:da ixl0: PCI Express Bus: Speed 8.0GT/s Width x8 ixl0: Failed to initialize SR-IOV (error=3D2) ixl1: mem 0xec000000-0xecffffff,0xee000000-0xee007fff at device 0.1 on pci1 ixl1: using 1024 tx descriptors and 1024 rx descriptors ixl1: fw 6.81.49447 api 1.7 nvm 6.80 etid 80003d71 oem 18.4608.9 ixl1: PF-ID[1]: VFs 64, MSIX 129, VF MSIX 5, QPs 768, I2C ixl1: Using MSIX interrupts with 9 vectors ixl1: Allocating 8 queues for PF LAN VSI; 8 queues active ixl1: Ethernet address: e4:43:4b:7c:f3:dc ixl1: PCI Express Bus: Speed 8.0GT/s Width x8 ixl1: Failed to initialize SR-IOV (error=3D2) pcib2: at device 1.3 on pci0 pci2: on pcib2 pcib3: at device 0.0 on pci2 pci3: on pcib3 vgapci0: mem 0xeb000000-0xebffffff,0xf9808000-0xf9= 80bfff,0xf9000000-0xf97fffff at device 0.0 on pci3 vgapci0: Boot video device pcib4: at device 1.4 on pci0 pci4: on pcib4 igb0: mem 0xf9f00= 000-0xf9ffffff,0xfa004000-0xfa007fff at device 0.0 on pci4 igb0: Using MSIX interrupts with 9 vectors igb0: Ethernet address: e4:43:4b:7c:f3:fa igb0: Bound queue 0 to cpu 0 igb0: Bound queue 1 to cpu 1 igb0: Bound queue 2 to cpu 2 igb0: Bound queue 3 to cpu 3 igb0: Bound queue 4 to cpu 4 igb0: Bound queue 5 to cpu 5 igb0: Bound queue 6 to cpu 6 igb0: Bound queue 7 to cpu 7 igb1: mem 0xf9e00= 000-0xf9efffff,0xfa000000-0xfa003fff at device 0.1 on pci4 igb1: Using MSIX interrupts with 9 vectors igb1: Ethernet address: e4:43:4b:7c:f3:fb igb1: Bound queue 0 to cpu 8 igb1: Bound queue 1 to cpu 9 igb1: Bound queue 2 to cpu 10 igb1: Bound queue 3 to cpu 11 igb1: Bound queue 4 to cpu 12 igb1: Bound queue 5 to cpu 13 igb1: Bound queue 6 to cpu 14 igb1: Bound queue 7 to cpu 15 pcib5: at device 7.1 on pci0 pci5: on pcib5 pci5: at device 0.0 (no driver attached) pci5: at device 0.2 (no driver attached) xhci0: mem 0xf9b00000-0xf9bfffff at dev= ice 0.3 on pci5 xhci0: 64 bytes context size, 64-bit DMA xhci0: Unable to map MSI-X table usbus0 on xhci0 usbus0: 5.0Gbps Super Speed USB v3.0 pcib6: at device 8.1 on pci0 pci6: on pcib6 pci6: at device 0.0 (no driver attached) pci6: at device 0.1 (no driver attached) ahci0: mem 0xf9a02000-0xf9a02fff at devic= e 0.2 on pci6 ahci0: AHCI v1.31 with 1 6Gbps ports, Port Multiplier supported with FBS ahcich0: at channel 0 on ahci0 isab0: at device 20.3 on pci0 isa0: on isab0 pcib7: on acpi0 pci7: on pcib7 amdsmn1: on hostb71 amdtemp1: on hostb71 pci7: at device 0.2 (no driver attached) pcib8: at device 7.1 on pci7 pci8: on pcib8 pci8: at device 0.0 (no driver attached) pci8: at device 0.2 (no driver attached) xhci1: mem 0xe8200000-0xe82fffff at dev= ice 0.3 on pci8 xhci1: 64 bytes context size, 64-bit DMA xhci1: Unable to map MSI-X table usbus1 on xhci1 usbus1: 5.0Gbps Super Speed USB v3.0 pcib9: at device 8.1 on pci7 pci9: on pcib9 pci9: at device 0.0 (no driver attached) pci9: at device 0.1 (no driver attached) pcib10: on acpi0 pci10: on pcib10 amdsmn2: on hostb78 amdtemp2: on hostb78 pci10: at device 0.2 (no driver attached) pcib11: at device 7.1 on pci10 pci11: on pcib11 pci11: at device 0.0 (no driver attached) pci11: at device 0.2 (no driver attached) pcib12: at device 8.1 on pci10 pci12: on pcib12 pci12: at device 0.0 (no driver attached) pci12: at device 0.1 (no driver attached) pcib13: on acpi0 pci13: on pcib13 amdsmn3: on hostb85 amdtemp3: on hostb85 pci13: at device 0.2 (no driver attached) pcib14: at device 3.1 on pci13 pci14: on pcib14 AVAGO MegaRAID SAS FreeBSD mrsas driver version: 07.709.04.00-fbsd mrsas0: port 0x7000-0x70ff mem 0xce600000-0xce6= 0ffff,0xce500000-0xce5fffff at device 0.0 on pci14 mrsas0: FW now in Ready state mrsas0: Using MSI-X with 96 number of vectors mrsas0: FW supports <96> MSIX vector,Online CPU 128 Current MSIX <96> mrsas0: max sge: 0x46, max chain frame size: 0x400, max fw cmd: 0xef mrsas0: Issuing IOC INIT command to FW. mrsas0: IOC INIT response received from FW. mrsas0: System PD created target ID: 0x0 mrsas0: System PD created target ID: 0x1 mrsas0: System PD created target ID: 0x2 mrsas0: System PD created target ID: 0x3 mrsas0: System PD created target ID: 0x4 mrsas0: System PD created target ID: 0x5 mrsas0: System PD created target ID: 0x6 mrsas0: System PD created target ID: 0x7 mrsas0: FW supports: UnevenSpanSupport=3D1 mrsas0: max_fw_cmds: 239=C2=A0 max_scsi_cmds: 223 mrsas0: MSI-x interrupts setup success mrsas0: mrsas_ocr_thread pcib15: at device 3.3 on pci13 pci15: on pcib15 ahci1: port 0x6028-0x602f,0x6034-0x= 6037,0x6020-0x6027,0x6030-0x6033,0x6000-0x601f mem 0xce400000-0xce4007ff at= device 0.0 on pci15 ahci1: AHCI v1.20 with 3 6Gbps ports, Port Multiplier not supported ahci1: quirks=3D0x900 ahcich1: at channel 0 on ahci1 ahcich2: at channel 1 on ahci1 ahcich3: at channel 2 on ahci1 pcib16: at device 7.1 on pci13 pci16: on pcib16 pci16: at device 0.0 (no driver attached) pci16: at device 0.2 (no driver attached) pcib17: at device 8.1 on pci13 pci17: on pcib17 pci17: at device 0.0 (no driver attached) pci17: at device 0.1 (no driver attached) pcib18: on acpi0 pci18: on pcib18 amdsmn4: on hostb92 amdtemp4: on hostb92 pci18: at device 0.2 (no driver attached) pcib19: at device 7.1 on pci18 pci19: on pcib19 pci19: at device 0.0 (no driver attached) pci19: at device 0.2 (no driver attached) pcib20: at device 8.1 on pci18 pci20: on pcib20 pci20: at device 0.0 (no driver attached) pci20: at device 0.1 (no driver attached) pcib21: on acpi0 pci21: on pcib21 amdsmn5: on hostb99 amdtemp5: on hostb99 pci21: at device 0.2 (no driver attached) pcib22: at device 7.1 on pci21 pci22: on pcib22 pci22: at device 0.0 (no driver attached) pci22: at device 0.2 (no driver attached) pcib23: at device 8.1 on pci21 pci23: on pcib23 pci23: at device 0.0 (no driver attached) pci23: at device 0.1 (no driver attached) pcib24: on acpi0 pci24: on pcib24 amdsmn6: on hostb106 amdtemp6: on hostb106 pci24: at device 0.2 (no driver attached) pcib25: at device 7.1 on pci24 pci25: on pcib25 pci25: at device 0.0 (no driver attached) pci25: at device 0.2 (no driver attached) pcib26: at device 8.1 on pci24 pci26: on pcib26 pci26: at device 0.0 (no driver attached) pci26: at device 0.1 (no driver attached) pcib27: on acpi0 pci27: on pcib27 amdsmn7: on hostb113 amdtemp7: on hostb113 pci27: at device 0.2 (no driver attached) pcib28: at device 7.1 on pci27 pci28: on pcib28 pci28: at device 0.0 (no driver attached) pci28: at device 0.2 (no driver attached) pcib29: at device 8.1 on pci27 pci29: on pcib29 pci29: at device 0.0 (no driver attached) pci29: at device 0.1 (no driver attached) uart1: <16550 or compatible> port 0x2f8-0x2ff irq 3 on acpi0 uart0: <16550 or compatible> port 0x3f8-0x3ff irq 4 flags 0x10 on acpi0 ipmi0: port 0xca8,0xcac irq 10 on acpi0 ipmi0: KCS mode found at io 0xca8 on acpi orm0: at iomem 0xed800-0xf17ff on isa0 amdsbwd0: at iomem 0xfed80b00-0xfed80b03,= 0xfed80b04-0xfed80b07 on isa0 random: unblocking device. ZFS filesystem version: 5 ZFS storage pool version: features support (5000) Timecounters tick every 1.000 msec freenas_sysctl: adding account. freenas_sysctl: adding directoryservice. freenas_sysctl: adding middlewared. freenas_sysctl: adding network. freenas_sysctl: adding services. ipfw2 (+ipv6) initialized, divert enabled, nat enabled, default to accept, = logging disabled ugen0.1: <0x1022 XHCI root HUB> at usbus0 ugen1.1: <0x1022 XHCI root HUB> at usbus1 mrsas0: Disestablish mrsas intr hook ipmi0: IPMI device rev. 1, firmware rev. 3.34, version 2.0 ipmi0: Number of channels 0 ipmi0: Attached watchdog uhub0: <0x1022 XHCI root HUB, class 9/0, rev 3.00/1.00, addr 1> on usbus1 uhub1: <0x1022 XHCI root HUB, class 9/0, rev 3.00/1.00, addr 1> on usbus0 uhub0: 4 ports with 4 removable, self powered uhub1: 4 ports with 4 removable, self powered ahcich3: stopping AHCI engine failed ugen0.2: at usbus0 uhub2 on uhub1 ahcich3: uhub2: stopping AHCI engine failed on usbus0 uhub2: 4 ports with 4 removable, self powered ugen0.3: at usbus0 uhub3 on uhub2 uhub3: on = usbus0 uhub3: 4 ports with 4 removable, self powered ugen0.4: at usbus0 uhub4 on uhub2 uhub4: on = usbus0 uhub4: 4 ports with 4 removable, self powered ugen0.5: at usbus0 uhub5 on uhub1 uhub5: on usbus0 uhub5: MTT enabled uhub5: 4 ports with 4 removable, self powered ugen0.6: at usbus0 uhub6 on uhub1 uhub6: on usbus0 uhub6: 4 ports with 4 removable, self powered da1 at mrsas0 bus 1 scbus2 target 1 lun 0 da0 at mrsas0 bus 1 scbus2 target 0 lun 0 da2 at mrsas0 bus 1 scbus2 target 2 lun 0 da3 at mrsas0 bus 1 scbus2 target 3 lun 0 da4 at mrsas0 bus 1 scbus2 target 4 lun 0 da6 at mrsas0 bus 1 scbus2 target 6 lun 0 da5 at mrsas0 bus 1 scbus2 target 5 lun 0 da7 at mrsas0 bus 1 scbus2 target 7 lun 0 da1: da4: da5: da7: da6: da2: Fixed Direct Acce= ss SPC-4 SCSI device Fixed Direct Access SPC-4 SCSI device Fixed Direct Access SPC-4 SCSI device Fixed Direct Access SPC-4 SCSI device da0: da6: Serial Number 8CH22H6H Fixed Direct Access SPC-4 SCSI device da5: Serial Number 8CH1BZPG da4: Serial Number 8CH1BA8G da2: Serial Number 8CH23NZH Fixed Direct Access SPC-4 SCSI device da4: 150.000MB/s transfersda1: Serial Number 8CGGWDSG da7: Serial Number 8CGGUHZG da1: 150.000MB/s transfersda2: 150.000MB/s transfersda5: 150.000MB/s transf= ers da7: 150.000MB/s transfers da3: da4: 11211776MB (22961717248 512 byte sectors) da6: 150.000MB/s transfersda2: 11211776MB (22961717248 512 byte sectors) da1: 11211776MB (22961717248 512 byte sectors) Fixed Direct Access SPC-4 SCSI device da7: 11211776MB (22961717248 512 byte sectors) Fixed Direct Access SPC-4 SCSI device da0: Serial Number 8CH21GAH da6: 11211776MB (22961717248 512 byte sectors) da5: 11211776MB (22961717248 512 byte sectors) da0: 150.000MB/s transfers da3: Serial Number 8CGXELAG da0: 11211776MB (22961717248 512 byte sectors) da3: 150.000MB/s transfers da3: 11211776MB (22961717248 512 byte sectors) pass8 at ahcich3 bus 0 scbus5 target 0 lun 0 pass8: Removable Processor SCSI device pass8: Serial Number HKDP221516WL pass8: 150.000MB/s transfers (SATA 1.x, UDMA4, ATAPI 12bytes, PIO 8192bytes= ) Trying to mount root from zfs:freenas-boot/ROOT/default []... lo0: link state changed to UP igb1: link state changed to UP hwpmc: SOFT/16/64/0x67 TSC/1/64/0x20 F17H/6/48/0x= 1ff igb1: link state changed to DOWN igb1: link state changed to UP root@freenas[~]# Thank you! P. From owner-freebsd-questions@freebsd.org Wed Jul 17 19:11:44 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0D861B3878 for ; Wed, 17 Jul 2019 19:11:44 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out3-smtp.messagingengine.com (out3-smtp.messagingengine.com [66.111.4.27]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 2213D8FB33 for ; Wed, 17 Jul 2019 19:11:43 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id A819821EFE for ; Wed, 17 Jul 2019 15:11:39 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Wed, 17 Jul 2019 15:11:39 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:mime-version:content-type; s= fm3; bh=YzotUF0Mygv+SzAkiIJfTO0yyEl31T4jXhUY/tdFCUM=; b=CirGvEc3 WSLSO/AKbGVjr042Gt36tgDBdJ9b2QCi+PhLh+kNpJVysAoprXSUDvCele54w7Ev GXKYcdSRGjNatGZZ/CfwQfQM/f3ibJfPXXL8GYX2NPbIOTh2K69+kuLdknfY/Oge JddwpEFRRrrM/QW6MkqlS4t4ovGpWU14IamREksjB7cLcvTNTXofhfr9b0pPBYak 0snf7/YXyQb2Yg76TvSxy1PximjbIyPAU3thjHMqUiCSoSAp8Vdg4fnDqu3W/lqI 7wgwvDfUKbU5EnimulHfci85/ha5nv5o/dpgYAe8VWsJl2Q28/1hUiB8N2UuWCoy qdopttFhi0HD4Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-proxy:x-me-proxy:x-me-sender :x-me-sender:x-sasl-enc; s=fm3; bh=YzotUF0Mygv+SzAkiIJfTO0yyEl31 T4jXhUY/tdFCUM=; b=nMhYCZFjr348wEVoxf5IfYsd90BMg/8rDPkiGQWEnfcvA F9YgWkgVpyYmcOobfQU5sVMr2Gd/7HgsrtjdOhyUozvnaEwINBp7WzBRFq+hdCEo XkVQYj1i7aX5Px4RBNofmbQR8PNhk472Uz1d3z8k4sJutG6mxzy8uTzRnw4NzXuh eqitAAybtjfRXtxm0E9uaUWuacB3O4h6xtmVo3VfTRhUsEkQxap6FffQncNZdcqm lZmLcp312U4Qme7Ddcagak/uGTFxECZBuW41XVglhedfiduhwmflTiKd432d/NG2 2n1pBJHItpSqPlh4qc/PdUFB/pqc/h/VGcf1gMbIg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieefgdduuddvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpeffhffvuffkgggtuggfsehgtderre dtredvnecuhfhrohhmpehtvggthhdqlhhishhtshcuoehtvggthhdqlhhishhtshesiiih gihsthdrnhgvtheqnecuffhomhgrihhnpehfrhgvvggsshgurdhorhhgnecukfhppeekvd drjedtrdeluddrleelnecurfgrrhgrmhepmhgrihhlfhhrohhmpehtvggthhdqlhhishht shesiiihgihsthdrnhgvthenucevlhhushhtvghrufhiiigvpedt X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id CA50A8005B for ; Wed, 17 Jul 2019 15:11:38 -0400 (EDT) Date: Wed, 17 Jul 2019 20:11:36 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: freebsd-update metadata error / 12.0-RELEASE-p7 Message-ID: <20190717191136.GB58456@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="s2ZSL+KKDSLx8OML" Content-Disposition: inline User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 2213D8FB33 X-Spamd-Bar: --------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=CirGvEc3; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=nMhYCZFj; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.27 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-9.22 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.27]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; MX_GOOD(-0.01)[cached: in2-smtp.messagingengine.com]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-0.99)[-0.995,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; IP_SCORE(-3.52)[ip: (-9.78), ipnet: 66.111.4.0/24(-4.78), asn: 11403(-2.98), country: US(-0.05)]; RCVD_IN_DNSWL_LOW(-0.10)[27.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Jul 2019 19:11:44 -0000 --s2ZSL+KKDSLx8OML Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi, context:=20 # freebsd-version -ku 12.0-RELEASE-p7 12.0-RELEASE-p7 freebsd-update fetch gives the following error: # freebsd-update fetch Looking up update.FreeBSD.org mirrors... 2 mirrors found. Fetching metadata signature for 12.0-RELEASE from update1.freebsd.org... done. Fetching metadata index... done. Fetching 2 metadata files... failed. How to fix? thanks, --=20 J. --s2ZSL+KKDSLx8OML Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0vct4ACgkQs8o7QhFz NAUNug//WN8yG7wW/8djAmRgwRrqgdNPUwbXnPEGsAHmDeVzEa0vePFLCB4EskQp XCqZMvEw3mjkEZyyb/b9Asd3wKGzNsc0TS59LU6SKRQNRj9gCxrmYARK/23Pjgie ul2EDm1mn0Y5tzFMlI2XtcSX/so/45TEa2ScwwfqjR6jEpJWGA4I936Sr173GcOx T1BKl3csTjcRvHZK+UHuZmNLCcAq1AU8qohQNUp44ifU5NeKvxddzc9gO/981BM+ XeI83JPVLet7km2GGEo7EXkugBd14hs/MBvktN2NLXdgIlMJI20FH1in937PB8sl WTqSE2Dc44b951qMoPRAO0jXRF0tP7xuCCd29rmuELDu6iI/hHsD3dbCh/kUvSNQ l3wFz6zTXzon0ITdko0YLoMrhvlK3ObcF2zbY+hLdhMZyDzrEKR878QxMOBjVPrh D2uOmiHBbBpwd3pmIHdiiNf3gDlJJCfdBHGuLOkN+h/4+898bz661FrTlflo7uPK IcA+fgE95bffuxeJkVxy1TKgGr+APNqj3jYgHn1QZUbm11fmrJWto9GUbGAgmeiR qEzcu2zUFJI/b48TZbXAa3DfKvmgztuYGJOQHzxIDmvnC19RVnjc3bOd1CE+Zw7F UmXZjULI8tVpIJkGg4mXXPy3c/Xjm2nuj6JqlRWUKpOIj5IteyU= =Sd+o -----END PGP SIGNATURE----- --s2ZSL+KKDSLx8OML-- From owner-freebsd-questions@freebsd.org Thu Jul 18 12:19:40 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 68280A77AF for ; Thu, 18 Jul 2019 12:19:40 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out5-smtp.messagingengine.com (out5-smtp.messagingengine.com [66.111.4.29]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 9E26E871C9 for ; Thu, 18 Jul 2019 12:19:38 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 6C7F72230E for ; Thu, 18 Jul 2019 08:19:32 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Thu, 18 Jul 2019 08:19:32 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm3; bh=XewSDo9dJY24dvNr0MovNJsu0Qh 3y1KUQSzt1pXP2yk=; b=gYDMK9UN0SX2cVGRbhqGyE2IisuXmBE2mf4yl89R0ri I5nRkYsRA6MVqAnQ1wPjPKMU6e3eI50XlUybsPzXpsW6h/1nfLVeq0zQWJOIp5vq bLq4FcsKSxZSQ5JLGIyD29rZZsT4mwmL5N5HmLhrtnovIP6PA7SHzM8XzTQ8ZU1T LNnxpyvzbTVn8HPjs+T7S0Bzb+LizS04noKJnc3RM9ND1ea9FPhI1f9lqUlpkb9c SkMGHxn6u2K8G7U478reC7cO+3KDkf0rmCnDjmXlpD7Tkto8YvzK5ej9jXv2DIZX DmOalf/nfEmHyc9hJiiw7xXKsmaY16mXqbyyf2a5PqQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=XewSDo 9dJY24dvNr0MovNJsu0Qh3y1KUQSzt1pXP2yk=; b=ljIWNirrNthnxQgNGWMBnU 9ceOwY1eORuCZyqXmrgfkLkSAldhonOVeUOi16UmUyCm+Jq3U9tCcIZx4+GSd+iu Prhywkvco3vdVv1J0a8h92ZzDIX3zjqfi/8tA+RAfVMQsnvEFNgmp5tDC3MfDNdT yHmdQXnXanXXyhgxsW+xcs45SVQ1OHbwM8sE/kUI9drZzOGsVuZM/vA2mE24NhFY ESsNmy9HSpUcXrLf0vUN7Adpbjafy/TlRe8ro4OtRp66EDDbF+T+KChqCUPL8GQ8 5m29q2ybi3/2vZGag1K5us272LJ9bauQrZdE3xOBidpDHrH+6l4F/C6kCklqS8xA == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieehgdehvdcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjfgesghdtre ertdervdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseii hiigshhtrdhnvghtqeenucfkphepkedvrdejtddrledurdelleenucfrrghrrghmpehmrg hilhhfrhhomhepthgvtghhqdhlihhsthhsseiihiigshhtrdhnvghtnecuvehluhhsthgv rhfuihiivgeptd X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id AF8E480059 for ; Thu, 18 Jul 2019 08:19:31 -0400 (EDT) Date: Thu, 18 Jul 2019 13:19:29 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: Re: how to upgrade mysql56-server to mysql57-server? Message-ID: <20190718121929.GA61693@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org References: <2AE8B6FE-CA25-4460-8629-B289BCB0BDFC@contoso.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="h31gzZEtNLTqOjlF" Content-Disposition: inline In-Reply-To: <2AE8B6FE-CA25-4460-8629-B289BCB0BDFC@contoso.com> User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 9E26E871C9 X-Spamd-Bar: -------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=gYDMK9UN; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=ljIWNirr; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.29 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-8.14 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.29]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; MX_GOOD(-0.01)[in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com,in2-smtp.messagingengine.com,in1-smtp.messagingengine.com]; NEURAL_HAM_SHORT(-0.91)[-0.910,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; RCVD_TLS_LAST(0.00)[]; IP_SCORE(-3.52)[ip: (-9.81), ipnet: 66.111.4.0/24(-4.79), asn: 11403(-2.98), country: US(-0.05)]; RCVD_IN_DNSWL_LOW(-0.10)[29.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 12:19:40 -0000 --h31gzZEtNLTqOjlF Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Wed, Jul 17, 2019 at 02:48:51PM +0000, Bruce Cantrall wrote: > >Can anyone else confirm that they seen my.cnf in multiple directories? >Bruce C Hi, Yes, it used to be in /usr/local (or /usr/local/etc or even /var/db/mysql)= =20 but is now (5.7) in /usr/local/etc/mysql. I removed my.cnf from the other locations. In the end, it was too problematic timewise for me to follow the=20 now-default mysqld version, because even after getting it running,=20 some tables weren't being read. So I restored the vm to pre-upgrade,=20 and added a line to make.conf for the poudriere instance corresponding=20 to the vm: DEFAULT_VERSIONS+=3Dmysql=3D5.6 and I was then able to use pkg normally. I'll upgrade to 5.7 when there's a clear upgrade method.=20 --=20 J. --h31gzZEtNLTqOjlF Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0wY8cACgkQs8o7QhFz NAWovQ/+POy9c1ljP6azPUuNevWIUwnZIpx3zjaOZDavkSWszaDs5+J7Nqb8vHun ngW0E/lM15WuQlpAVnIkWbo5rarfVtaXg4pQnF1b7yCEWbVYK8FNoQOqDS2ZpSSI ZLduXcCQf06Pn2Zf7738/KHZrRXpcob791dGJFNC/eWDVZgQIyGZBKbrb800xxYT iTTw+qSBmHYqf5hArfVeQrNL6eAuMt4XdOAJhVyejjsZ+Udq5gikKmjW0nth6dJy nl+1h9aPlF8U0AAlw3w5CT96q2SVqKbEiF20gjsoygPmZ6u32jDhCcQQwn/v+CFt eKhRa1ftRprTMBTnvADm5sIBp+0SZlCruQnOXf++OPEOrROkWzUNA3J9f95/mYwD EA4ciwB5elpDbI+LrFxu2TIG+wPdpphZl3chFaJsLkYisg5NDlKcbkUkyObiuU+V XqQJFQ8byI1IxY5ArMcXupG+xhuEdh++cyUaUgBwenhYQ+INM6cWJGSDIdYfJAIw NP5SfQ5piYBOEEPvz//KDcyYCARPcjDLlGYZWyIP9WrEVzoRj9baOelOSntLMdr3 vfcWgYs1k71HZeGPkHEc65MGDzwlxGOlc4qqjtyT44itHS2T+Xn91JK2YouLltWX AAetJu9SM9oy4Q3ewD1AZ6+rNtuMdaBt0FXPIkSNyLnmHi02CZY= =q7fO -----END PGP SIGNATURE----- --h31gzZEtNLTqOjlF-- From owner-freebsd-questions@freebsd.org Thu Jul 18 14:31:43 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 14566A9D77 for ; Thu, 18 Jul 2019 14:31:43 +0000 (UTC) (envelope-from david@88watts.net) Received: from brown.elm.relay.mailchannels.net (brown.elm.relay.mailchannels.net [23.83.212.23]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 8FCEB8B4D5 for ; Thu, 18 Jul 2019 14:31:41 +0000 (UTC) (envelope-from david@88watts.net) X-Sender-Id: dreamhost|x-authsender|david@88watts.net Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id BF4D8140F98 for ; Thu, 18 Jul 2019 14:31:33 +0000 (UTC) Received: from pdx1-sub0-mail-a88.g.dreamhost.com (100-96-83-224.trex.outbound.svc.cluster.local [100.96.83.224]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 0CAB614259C for ; Thu, 18 Jul 2019 14:31:33 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|david@88watts.net Received: from pdx1-sub0-mail-a88.g.dreamhost.com ([TEMPUNAVAIL]. [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.17.3); Thu, 18 Jul 2019 14:31:33 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|david@88watts.net X-MailChannels-Auth-Id: dreamhost X-Abaft-Tasty: 1425adc71f8cdcde_1563460293583_1392337803 X-MC-Loop-Signature: 1563460293583:4263694872 X-MC-Ingress-Time: 1563460293583 Received: from pdx1-sub0-mail-a88.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a88.g.dreamhost.com (Postfix) with ESMTP id 8C32180CC9 for ; Thu, 18 Jul 2019 07:31:32 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=88watts.net; h=message-id :from:to:date:reply-to:mime-version:content-type :content-transfer-encoding:subject; s=88watts.net; bh=hGiN+zBSRi SvtYpmKrrlSTOIr34=; b=EF1+znNLv3/8EfrQ8hB9UpMH/2IKAZtFlhftfe351v dy6kJm4ePC/obzFO3EuHEDVqT+k8ScT962inwBkZuAQy5x2r2h6vkh7o2gZSVozk 5sx/FEzyhFxvRWFYNQp+/PKfFsKT+pMkYiVVoG24QNMT9+1elQ4DCJ4676cu8ebe 4= Received: from DAZAR1 (unknown [50.105.97.110]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: david@88watts.net) by pdx1-sub0-mail-a88.g.dreamhost.com (Postfix) with ESMTPSA id EF7A980CB1 for ; Thu, 18 Jul 2019 07:31:31 -0700 (PDT) Message-ID: <100.908e0e00be82305d.007@88watts.net> X-DH-BACKEND: pdx1-sub0-mail-a88 From: "David Azarewicz" To: "freebsd-questions@FreeBSD.org" Date: Thu, 18 Jul 2019 10:31:26 -0400 (EDT) Reply-To: "David Azarewicz" Priority: Normal User-Agent: PMMail/3.22 (os/2; U; Warp 4.5; en-US; i386; ver 3.22.00.2301) X-Mailer: PMMail 3.22.00.2301 for OS/2 Warp 4.5 MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7bit Subject: Cannot build generic kernel X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 50 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrieehgdektdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecuogfvvgigthfqnhhlhidqqdetfeejfedqtdegucdlhedtmdenucfjughrpefkhffvffhrfgfogggtgffusehtjeertderreejnecuhfhrohhmpedfffgrvhhiugcuteiirghrvgifihgtiidfuceouggrvhhiugeskeekfigrthhtshdrnhgvtheqnecuffhomhgrihhnpehfrhgvvggsshgurdhorhhgpdhprhgvrdhmkhenucfkphephedtrddutdehrdeljedruddutdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghlohepffetkgettfdupdhinhgvthephedtrddutdehrdeljedruddutddprhgvthhurhhnqdhprghthhepfdffrghvihguucetiigrrhgvfihitgiifdcuoegurghvihguseekkeifrghtthhsrdhnvghtqedpmhgrihhlfhhrohhmpegurghvihguseekkeifrghtthhsrdhnvghtpdhnrhgtphhtthhopehfrhgvvggsshguqdhquhgvshhtihhonhhssefhrhgvvgeuufffrdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Rspamd-Queue-Id: 8FCEB8B4D5 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=88watts.net header.s=88watts.net header.b=EF1+znNL; spf=pass (mx1.freebsd.org: domain of david@88watts.net designates 23.83.212.23 as permitted sender) smtp.mailfrom=david@88watts.net X-Spamd-Result: default: False [-2.63 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[david@88watts.net]; R_SPF_ALLOW(-0.20)[+ip4:23.83.208.1/20]; DKIM_TRACE(0.00)[88watts.net:+]; MX_GOOD(-0.01)[vade-in1.mail.dreamhost.com,vade-in2.mail.dreamhost.com]; NEURAL_HAM_SHORT(-0.41)[-0.414,0]; FROM_EQ_ENVFROM(0.00)[]; IP_SCORE(0.19)[ipnet: 23.83.208.0/21(0.57), asn: 36483(0.46), country: CA(-0.09)]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:36483, ipnet:23.83.208.0/21, country:CA]; RCVD_TLS_LAST(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.90)[-0.897,0]; R_DKIM_ALLOW(-0.20)[88watts.net:s=88watts.net]; RCVD_COUNT_FIVE(0.00)[6]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-0.996,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[88watts.net]; RCPT_COUNT_ONE(0.00)[1]; REPLYTO_EQ_FROM(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[23.212.83.23.list.dnswl.org : 127.0.3.0]; TO_DN_EQ_ADDR_ALL(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 14:31:43 -0000 I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img I checked out base/stable/12 r350009 using svnlite I followed the directions on https://www.freebsd.org/doc/handbook/kernelconfig-building.html for building the kernel. I get an error: make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 kernel requires linker ifunc support both make buildkernel and make buildkernel KERNCONF=GENERIC fail exactly the same way. Today I updated to r350112 and the problem persists. So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a fresh unmodified checkout of FreeBSD 12 stable, I followed the directions for building the standard, default, generic kernel and it fails. I tried searching for a solution to this problem and could not find a solution. How can I fix this problem? Thanks, David ----- David Azarewicz From owner-freebsd-questions@freebsd.org Thu Jul 18 14:39:29 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5082BA9FF9 for ; Thu, 18 Jul 2019 14:39:29 +0000 (UTC) (envelope-from trond.endrestol@ximalas.info) Received: from enterprise.ximalas.info (enterprise.ximalas.info [IPv6:2001:700:1100:1::8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ximalas.info", Issuer "Hostmaster ximalas.info" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id AC95A8B84C for ; Thu, 18 Jul 2019 14:39:28 +0000 (UTC) (envelope-from trond.endrestol@ximalas.info) Received: from enterprise.ximalas.info (Ximalas@localhost [127.0.0.1]) by enterprise.ximalas.info (8.15.2/8.15.2) with ESMTPS id x6IEdKQu091485 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Thu, 18 Jul 2019 16:39:20 +0200 (CEST) (envelope-from trond.endrestol@ximalas.info) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=ximalas.info; s=default; t=1563460761; bh=apN6bn7vZv/ttEFXrr8paWdBYLHFMuGhEcUsSvsxuLs=; h=Date:From:To:Subject:In-Reply-To:References; b=Bzlss3FMNuGLOkSxH1TUs+NLO+lZn+Fxhd6Huq59y+dGhfC57gYd6fAMrecQYjiiQ 8BLAS3xIVUZST3DaeZ+MKo2H+BNJ2+D5V/4W4ZeW1lA5k0KnKj3z2KrWAYnKRpgMvx lC4nKI6TH9ikt1Zlgvd7fn8d4oONwo+CeDmQPf4YqQhQV2yEcXM39spcBayKtcteEO p6k2an0VHKTzlpwNyTFTwsvtflVeHCR92sn9CFvD0fdpKrSpYOON3X92QvRmo37DVW P/ctYfooplsgbrEPxMj3dNfK1KS6clQl9pCVPMJqAcqr2MfDMn5wyq+C7orxdJU1TE o83hGQBPknwCA== Received: from localhost (trond@localhost) by enterprise.ximalas.info (8.15.2/8.15.2/Submit) with ESMTP id x6IEdK2H091482 for ; Thu, 18 Jul 2019 16:39:20 +0200 (CEST) (envelope-from trond.endrestol@ximalas.info) X-Authentication-Warning: enterprise.ximalas.info: trond owned process doing -bs Date: Thu, 18 Jul 2019 16:39:20 +0200 (CEST) From: =?UTF-8?Q?Trond_Endrest=C3=B8l?= Sender: Trond.Endrestol@ximalas.info To: "freebsd-questions@FreeBSD.org" Subject: Re: Cannot build generic kernel In-Reply-To: <100.908e0e00be82305d.007@88watts.net> Message-ID: References: <100.908e0e00be82305d.007@88watts.net> User-Agent: Alpine 2.21.99999 (BSF 352 2019-06-22) OpenPGP: url=http://ximalas.info/about/tronds-openpgp-public-key MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII X-Spam-Status: No, score=-1.2 required=5.0 tests=ALL_TRUSTED,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,DKIM_VALID_EF autolearn=unavailable autolearn_force=no version=3.4.2 X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on enterprise.ximalas.info X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 14:39:29 -0000 On Thu, 18 Jul 2019 10:31-0400, David Azarewicz wrote: > I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img > > I checked out base/stable/12 r350009 using svnlite > > I followed the directions on https://www.freebsd.org/doc/handbook/kernelconfig-building.html > for building the kernel. > > I get an error: > make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 kernel requires linker > ifunc support > > both > make buildkernel > and > make buildkernel KERNCONF=GENERIC > fail exactly the same way. > > Today I updated to r350112 and the problem persists. > > So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a fresh unmodified > checkout of FreeBSD 12 stable, I followed the directions for building the standard, default, > generic kernel and it fails. I tried searching for a solution to this problem and could not find a > solution. How can I fix this problem? You're checking out stable/12, so why not download the latest stable/12 snapshot and install that one instead of 12.0-RELEASE? ftp://ftp.freebsd.org/pub/FreeBSD/snapshots/amd64/amd64/ISO-IMAGES/12.0/FreeBSD-12.0-STABLE-amd64-20190711-r349903-memstick.img -- Trond. From owner-freebsd-questions@freebsd.org Thu Jul 18 16:00:40 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2B253AB8A3 for ; Thu, 18 Jul 2019 16:00:40 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out4-smtp.messagingengine.com (out4-smtp.messagingengine.com [66.111.4.28]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 62C4D8E09E for ; Thu, 18 Jul 2019 16:00:39 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 062CF22342 for ; Thu, 18 Jul 2019 12:00:38 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Thu, 18 Jul 2019 12:00:38 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm3; bh=jDwZBM8BqAMAH49Tv6EtrtufhSq bl6CLYOCDwSyloxI=; b=P9Pqqp6LKLDPxU83PImcZm83dSa/9yTjMDmwzNIJXhU 9/EQjy1n9ZzLjNJNCGn0j7dUt5XPh/jktCvAX26YsazFrDn00ME/WgHidyMsVylC XDOSwNE1lSeS7xOaeWhpaWj2uApJLoIMAnRR39jjitAa4XIIaQXYpIHUJRM439GX GaKHzIbGJLjpMny2QI6FsmT1ruf11Hl0IQtwDvh/zPzAszELZi4IStxntJPrPBt2 9kbyMZZnbYXN7t0zNM8uT5phZV2/Bzrip/1sxDTcpMDcN9mSHn2OJR95krIFspDA Yy15MnTnNaaL3MookEbzZ6dTNSjs+poTyMNlC2GVM4w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=jDwZBM 8BqAMAH49Tv6EtrtufhSqbl6CLYOCDwSyloxI=; b=G8nYIGbxexfGwMjiqd1hFO +/8RT3krYo8fuhk7uehNTbX4xXL/EDAmCDWXMghBeJ1FnPRd8T4UWfZRhn5NTXRX gouPZsb1oLMAPf+cHf96Nfc6ZMOIILAUZkAeP2Ge4HX72bS9ZpyTulWTCiXHYChH vmaD/K5YumswfkncaYGtiGyjz8l6mJ6tCVMjC+5WlEKzPA0Mar9iqJdsAbdDT+yI Z8gaOv/JzdHck9byJ4JaXi4q9KpEy6/u/Arp6b4Iv6NngT3XI1CGbh7XMWagwHV1 NoGXFsgLJW30C2sNj2EigKfaQb8TH2Y1upFrj0UrFqcx8PCIq+TOrp0oJY8D48/A == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieehgdelkecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjfgesghdtre ertdervdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseii hiigshhtrdhnvghtqeenucffohhmrghinhepfhhrvggvsghsugdrohhrghenucfkphepke dvrdejtddrledurdelleenucfrrghrrghmpehmrghilhhfrhhomhepthgvtghhqdhlihhs thhsseiihiigshhtrdhnvghtnecuvehluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: from mon.zyxst.net (mon.zyxst.net [82.70.91.99]) by mail.messagingengine.com (Postfix) with ESMTPA id E05CD80061 for ; Thu, 18 Jul 2019 12:00:36 -0400 (EDT) Date: Thu, 18 Jul 2019 17:00:34 +0100 From: tech-lists To: freebsd-questions@freebsd.org Subject: Re: freebsd-update metadata error / 12.0-RELEASE-p7 Message-ID: <20190718160034.GA62081@mon.zyxst.net> Mail-Followup-To: freebsd-questions@freebsd.org References: <20190717191136.GB58456@mon.zyxst.net> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="a8Wt8u1KmwUX3Y2C" Content-Disposition: inline In-Reply-To: <20190717191136.GB58456@mon.zyxst.net> User-Agent: Mutt/1.12.1 (2019-06-15) X-Rspamd-Queue-Id: 62C4D8E09E X-Spamd-Bar: --------- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm3 header.b=P9Pqqp6L; dkim=pass header.d=messagingengine.com header.s=fm3 header.b=G8nYIGbx; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.28 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-9.23 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm3,messagingengine.com:s=fm3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.28]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; MX_GOOD(-0.01)[cached: in2-smtp.messagingengine.com]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-0.99)[-0.993,0]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; IP_SCORE(-3.52)[ip: (-9.80), ipnet: 66.111.4.0/24(-4.79), asn: 11403(-2.97), country: US(-0.05)]; RCVD_IN_DNSWL_LOW(-0.10)[28.4.111.66.list.dnswl.org : 127.0.5.1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 16:00:40 -0000 --a8Wt8u1KmwUX3Y2C Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Wed, Jul 17, 2019 at 08:11:36PM +0100, tech-lists wrote: >Hi, > >context: ># freebsd-version -ku >12.0-RELEASE-p7 >12.0-RELEASE-p7 > >freebsd-update fetch gives the following error: > ># freebsd-update fetch >Looking up update.FreeBSD.org mirrors... 2 mirrors found. >Fetching metadata signature for 12.0-RELEASE from update1.freebsd.org... >done. >Fetching metadata index... done. >Fetching 2 metadata files... failed. > >How to fix? Turned on debugging and it seems the affected system is looking for phttpget root@redacted:/var/db # freebsd-update -v debug fetch src component not installed, skipped Looking up update.FreeBSD.org mirrors... 2 mirrors found. Fetching metadata signature for 12.0-RELEASE from update1.freebsd.org...=20 latest.ssl 512 B 2109 kBps 00s done. Fetching metadata index...=20 dda4201ec2d4d713950e80e03c1430475b47087bf9ad13 225 B 964 kBps 00s done. Fetching 2 metadata files...=20 /usr/libexec/phttpget update1.freebsd.org 12.0-RELEASE/amd64/m/08f94cc15d9fc9737da1f0866ccc826be7a4f5945718273a582f39= a3cbf85184.gz 12.0-RELEASE/amd64/m/be338bb3947d92022912ad0e741ffa936ffc7008dd233ec81040cf= bba11a66c9.gz xargs: /usr/libexec/phttpget: No such file or directory failed. somehow it was missing, so got 12.0 sources, cd to /usr/src/usr.sbin/portsnap/phttpget then make && make install and now freebsd-update works as expected. hopefully this will be of use to others --=20 J. --a8Wt8u1KmwUX3Y2C Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAl0wl5kACgkQs8o7QhFz NAUHzhAAl8uwxAH2BtQ+ISdGicPPBdv6f4EAkYc/1qYg4Vxf69FQ220Ymu/cSs2k rHIDY8rW39ZjN/6LIak9QO2YqHlC4soTzz5NI3kRmhJrq17ziBWwlBOfzQFGBOf7 OUyrb0EgZH5AUqGQemxYpkWY45Y0ckIxTCkdxnx8DpVX+qJJQjKLiSOkRoI/oHHK FrBgMwC/QyGWuiDASZPJclYKz3UH6Wthaq1GSsZgXV8F+UUI9bcJF5QDtkVeKHTw SwkJgiSQRHmq/1bgxUTio9cFW4oU42DhnO++DDXhMT1m9EQVQy3CJv/BKFHzQIiY oB7mpInZqiZW6bFvqMTik1ue+E4Czl8l/WAuIHxXstZ2sNEzPt2VZOHHxnF+MER2 UMV4Mw91You299VK/rcNsI+wm/wObBhAC2Xa7tNF9AQyCI1aTgbumBg2CzdW57Go Jmc+N90GzTeRr62JZs8OXywx0174W3wQkl2LQju9NXEN0XcEF14CacviN3G8YuhP Iz6GjjBE8rWB5IyTG7IE3h2BHGbZCkzniZT6C/xWtvZdQf8CxrVKU4oZU2dk49Si 3hSgi0xkJVev7vCepA+iyniqb5wjZ49RMLbqFguzFYNwYRo7H5xEzo+g2odg+wlw mjycdqM/yXF/HqrFS8qoz8lfUyjd84HUnwLDAp7hP9++BOZY2TQ= =Tiz7 -----END PGP SIGNATURE----- --a8Wt8u1KmwUX3Y2C-- From owner-freebsd-questions@freebsd.org Thu Jul 18 17:13:22 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8A2CFAD48D for ; Thu, 18 Jul 2019 17:13:22 +0000 (UTC) (envelope-from eduardo.lemosdesa@gmail.com) Received: from mail-lf1-x141.google.com (mail-lf1-x141.google.com [IPv6:2a00:1450:4864:20::141]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 24A466A39C for ; Thu, 18 Jul 2019 17:13:22 +0000 (UTC) (envelope-from eduardo.lemosdesa@gmail.com) Received: by mail-lf1-x141.google.com with SMTP id c19so19758009lfm.10 for ; Thu, 18 Jul 2019 10:13:22 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:cc; bh=f2HwH/G18Keq3AmuueC5XtVQkKdqD0vkL5UbQdR2Ahk=; b=WVM5YhaKyCVaf8TgBmxaRoa2wWqtihuiBAU+diwfiCswrqbo0p+Gf9hIlpXFfg7Bhp EdZhq4OPUmb7IZyN9YCyUW95VkeIxFlLTZhi6R7YjhtxQ9uf6QW3i7LuF3WSWZorJ9EY s7Mlbl1dDdHSiklGtkj07LygTULSLb07B/Cp1B8WQhyLIk/tdfU32otnkMWBlQGRzf1g RBCYMtHT69/scKeTdjoN0m4+HPOveZRSPEmiWa1hXljoRUUna+x/UccYCgu9YIcToWtl 2c9lIiX6GGU0yZcIrHxcVUruU9QkwmcDAkLQDkKOGyr5UJi//SrglLYdU3n0zu8If1jU nefQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:cc; bh=f2HwH/G18Keq3AmuueC5XtVQkKdqD0vkL5UbQdR2Ahk=; b=p0sWBGUfmS7k7TS/7pDNARuW45ltkhdL9GJEWVZcAzX5BzYdAIacBBT6In7QN2kAw1 S9bi7ZktV/0GyP3/Y3ygeotAUm8Bb2KoThK+NbV+ns89ye10slO6qzZSKBu3o4ojeE3F 9MZ2zYJIprcAzzhpcCePYtoXHC1PGO5PF2b2x/UqPuWCX60Aqpu+IaaTi1qAnEIb7cDz euVNEoIOZv2I9OCrmm8NXQK0vzdJXGU8CiiOCo9yR9OtfRZNhKRHLQVsExoqWMApShiY Fis8gMYPkb4LzuQYZehjvnFXFOyWUFgB3z1uZ9fRrxMow2LvA+a/7WQrEMAD336xUnhT spaQ== X-Gm-Message-State: APjAAAX2mz8aLDz3VGHA2Qno741N3uuriFxLVqOPt6viKEaDwpAa8j+C ehy7tT/43ofUleJIoU7/h4NRE6Wc0O9p0gsjvdQYTtzCvc+l9w== X-Google-Smtp-Source: APXvYqysAURu7M2zJx9QO8REzmScLJjkIRWhCEB9SDXUx7sq5RfBBgxsVfxAST5mTN2j3U57ibpAAQ7tDm6rq0TNKD8= X-Received: by 2002:a19:6b0e:: with SMTP id d14mr21054630lfa.174.1563470000342; Thu, 18 Jul 2019 10:13:20 -0700 (PDT) MIME-Version: 1.0 References: <100.908e0e00be82305d.007@88watts.net> In-Reply-To: From: Eduardo Lemos de Sa Date: Thu, 18 Jul 2019 14:13:09 -0300 Message-ID: Subject: Re: Cannot build generic kernel Cc: "freebsd-questions@FreeBSD.org" X-Rspamd-Queue-Id: 24A466A39C X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-6.98 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; REPLY(-4.00)[]; NEURAL_HAM_SHORT(-0.98)[-0.980,0]; TAGGED_FROM(0.00)[] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 17:13:22 -0000 Dear On Thu, Jul 18, 2019 at 11:40 AM Trond Endrest=C3=B8l < trond.endrestol@ximalas.info> wrote: > On Thu, 18 Jul 2019 10:31-0400, David Azarewicz wrote: > > > I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img > > > > I checked out base/stable/12 r350009 using svnlite > > > > I followed the directions on > https://www.freebsd.org/doc/handbook/kernelconfig-building.html > > for building the kernel. > > > > I get an error: > > make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 > kernel requires linker > > ifunc support > > > > both > > make buildkernel > > and > > make buildkernel KERNCONF=3DGENERIC > > fail exactly the same way. > > > > Today I updated to r350112 and the problem persists. > > > > So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a > fresh unmodified > > checkout of FreeBSD 12 stable, I followed the directions for building > the standard, default, > > generic kernel and it fails. I tried searching for a solution to this > problem and could not find a > > solution. How can I fix this problem? > > You're checking out stable/12, so why not download the latest > stable/12 snapshot and install that one instead of 12.0-RELEASE? > > > ftp://ftp.freebsd.org/pub/FreeBSD/snapshots/amd64/amd64/ISO-IMAGES/12.0/F= reeBSD-12.0-STABLE-amd64-20190711-r349903-memstick.img > > -- > Trond. > I had problems to compile kernel GENERIC with 11.3-RELEASE last week. I solved this problem following instructions on https://forums.freebsd.org/threads/error-while-compiling-release-11-custom-= kernel-after-spectre-meltdown-updates.65555/ Shortelly, the solution is make kernel-toolchain buildkernel Cheers Edu > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > --=20 Eduardo Lemos de Sa Professor Titular Dep. Quimica da Universidade Federal do Paran=C3=A1 fone: +55(41)3361-3300 fax: +55(41)3361-3186 From owner-freebsd-questions@freebsd.org Thu Jul 18 19:35:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E80D3AF816 for ; Thu, 18 Jul 2019 19:35:08 +0000 (UTC) (envelope-from dave.mehler@gmail.com) Received: from mail-wr1-x42b.google.com (mail-wr1-x42b.google.com [IPv6:2a00:1450:4864:20::42b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 70FE76E9FF for ; Thu, 18 Jul 2019 19:35:07 +0000 (UTC) (envelope-from dave.mehler@gmail.com) Received: by mail-wr1-x42b.google.com with SMTP id g17so29928771wrr.5 for ; Thu, 18 Jul 2019 12:35:07 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=L2TMDemZcEn+qaJeQclD4uQyGiNE1mvCjbdC4dAH2g4=; b=YTAChqaa/AutuNKJuuS9QPxCRLuC0U52d49kHW/9Qe7vyiul2VFZUH/Du0LqmIiW8O GFNTfEiaEEWqgXuO6wEIEgFWcGucA6gaBE8BZS1QPqqHDQHoaKXdcg7Uaf6PqMLfX5yt Ddu1TbRcJwrjh+O/qHTJKLkTUbR62FyGMfm2J8keuUCCSAgik1cSJkX5wd2yjvD+ezY5 mqUbMr6MFb099rPlrum8X0vGfdrJFsnlC+w2lxDJ0j2hF1p09DoDZQNAc30WyTw9tMSp 4w4scKyrGu09dnXJzzRD0WDlxETReE94NZ+WKrslIjIV/e4wbEzOtEJKLBE4om33kAPZ crOA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=L2TMDemZcEn+qaJeQclD4uQyGiNE1mvCjbdC4dAH2g4=; b=iLj2TWxLv/l0xOteI807amJhSfFk6l8ZjMI0F3ZAXjGEC6XIIctBIQv8C0KDAF5cpT s3yY/kmlWYc18TeuuLgv1ip4DbLkc0iWbnKest6Iu0cLmFACeqPqtj/rj5QdFiUif8YJ /j8Ud3n6oZl+EjF+boALNtDjd6Ato07D+Q530+IA84KNKrsIz8BIR4Et/Mg2TCqFMO9F NjLAuGxHnco6kTVZjdrd81DCB1HE2nUNGbE0d0z+oFX7PjOlLOWtXQ6/QYUWUrNSiBvc ZYO9x/++AGq9joLlf4FiNFrvwXoMJb0lQaTS16Su0LyshHV9fuc7elDjNspsO1sW4pxx A4ow== X-Gm-Message-State: APjAAAUi44XEVd9Mo7mGC9InohFBh6RmS+CuWg0mMt1m9XCVDO6YX5Z0 QpbdltbXqKXhLPdz06m2n1u60nm/nv4Z5QJV657Gm3Mx X-Google-Smtp-Source: APXvYqz2TLLMGav2T347iYbFXxplhMJLKvpBU9hlYbXEo96juTDss4uuYeI+Wjomo8HT4eL+smMzp8FtL3RRzJTPvU4= X-Received: by 2002:a5d:4e06:: with SMTP id p6mr7922173wrt.336.1563478506080; Thu, 18 Jul 2019 12:35:06 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:adf:f011:0:0:0:0:0 with HTTP; Thu, 18 Jul 2019 12:35:05 -0700 (PDT) From: David Mehler Date: Thu, 18 Jul 2019 15:35:05 -0400 Message-ID: Subject: mod_pagespeed fails to stage on freebsd? To: freebsd-questions Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 70FE76E9FF X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=YTAChqaa; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of davemehler@gmail.com designates 2a00:1450:4864:20::42b as permitted sender) smtp.mailfrom=davemehler@gmail.com X-Spamd-Result: default: False [-5.95 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; NEURAL_HAM_SHORT(-0.98)[-0.984,0]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-0.999,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-2.96)[ip: (-9.38), ipnet: 2a00:1450::/32(-2.93), asn: 15169(-2.43), country: US(-0.05)]; RCVD_IN_DNSWL_NONE(0.00)[b.2.4.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0]; SUBJECT_ENDS_QUESTION(1.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 19:35:09 -0000 Hello, Do we have any users of mod_pagespeed with apache 2.4.x on a FreeBSD system? I'm having no luck compiling it via system ports as one of it's dependencies or one of it's dependencies dependencies requires opencv which is failing to stage properly. I am therefor stuck. Any ideas? Thanks. Dave. From owner-freebsd-questions@freebsd.org Thu Jul 18 19:54:52 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3150CAFD94 for ; Thu, 18 Jul 2019 19:54:52 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from dnvrco-cmomta03.email.rr.com (dnvrco-outbound-snat.email.rr.com [107.14.73.231]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id B87E16F3BB for ; Thu, 18 Jul 2019 19:54:49 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from localhost ([96.28.161.151]) by cmsmtp with ESMTP id oCM1hEUoVWnTioCM4h5tlN; Thu, 18 Jul 2019 19:46:16 +0000 Date: Thu, 18 Jul 2019 19:44:43 +0000 From: "Thomas Mueller" To: freebsd-questions@freebsd.org Subject: Re: Cannot build generic kernel References: <100.908e0e00be82305d.007@88watts.net> X-CMAE-Envelope: MS4wfDX9mwmhsY4H6qJtX1E3lVpfOpGVlUVHF3VSNlyF9c8MWMOT/GZG2hQdvxgqDrU/xjPGDSvCNSwcs/o0wj4VqpDUlt66A5MgMmsKoXIaQNEQ3gSmM9pR bVtfUFZRntX60vo/EmG5VtENv6CZZ9//wp5wLbJGC8tJYvI9PFePon5A/ncQ/stdg25DsQ9OCdguzA== X-Rspamd-Queue-Id: B87E16F3BB X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of mueller6722@twc.com designates 107.14.73.231 as permitted sender) smtp.mailfrom=mueller6722@twc.com X-Spamd-Result: default: False [-2.90 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.986,0]; RCVD_COUNT_TWO(0.00)[2]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:107.14.73.0/24]; FREEMAIL_FROM(0.00)[twc.com]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[twc.com]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-0.999,0]; MISSING_MID(2.50)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MX_GOOD(-0.01)[dnvrco-cmedge01.email.rr.com,dnvrco-cmedge02.email.rr.com]; NEURAL_HAM_SHORT(-0.70)[-0.703,0]; RCVD_IN_DNSWL_NONE(0.00)[231.73.14.107.list.dnswl.org : 127.0.5.0]; RCVD_TLS_LAST(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[151.161.28.96.zen.spamhaus.org : 127.0.0.10]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[twc.com]; ASN(0.00)[asn:7843, ipnet:107.14.73.0/24, country:US]; MIME_TRACE(0.00)[0:+]; IP_SCORE(-2.40)[ip: (-6.62), ipnet: 107.14.73.0/24(-2.96), asn: 7843(-2.37), country: US(-0.05)]; FROM_EQ_ENVFROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 19:54:52 -0000 from David Azarewicz: > I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img > I checked out base/stable/12 r350009 using svnlite > I followed the directions on https://www.freebsd.org/doc/handbook/kernelconfig-building.html > for building the kernel. > I get an error: > make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 kernel requires linker > ifunc support > both > make buildkernel > and > make buildkernel KERNCONF=GENERIC > fail exactly the same way. > Today I updated to r350112 and the problem persists. > So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a fresh unmodified > checkout of FreeBSD 12 stable, I followed the directions for building the standard, default, > generic kernel and it fails. I tried searching for a solution to this problem and could not find a > solution. How can I fix this problem? Did you make buildworld before attempting buildkernel? I read UPDATING in the top directory of the src tree, and you are supposed to "make buildworld" before buildkernel. That would put updated tools in place for buildkernel. Tom From owner-freebsd-questions@freebsd.org Thu Jul 18 20:24:55 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 888D7B0AE4 for ; Thu, 18 Jul 2019 20:24:55 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene.sentex.ca (unknown [IPv6:2607:f3e0:0:3::18]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "pyroxene.sentex.ca", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id F06D27084E for ; Thu, 18 Jul 2019 20:24:44 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [192.168.43.26] ([192.168.43.26]) by pyroxene.sentex.ca (8.15.2/8.15.2) with ESMTP id x6IKOeie026496; Thu, 18 Jul 2019 16:24:40 -0400 (EDT) (envelope-from mike@sentex.net) To: freebsd-questions From: Mike Tancsa Subject: zfs recv errors (g_dev_taste: make_dev_p() failed) Openpgp: preference=signencrypt Autocrypt: addr=mike@sentex.net; prefer-encrypt=mutual; keydata= mQENBEzcA24BCACpwI/iqOrs0GfQSfhA1v6Z8AcXVeGsRyKEKUpxoOYxXWc2z3vndbYlIP6E YJeifzKhS/9E+VjhhICaepLHfw865TDTUPr5D0Ed+edSsKjlnDtb6hfNJC00P7eoiuvi85TW F/gAxRY269A5d856bYrzLbkWp2lKUR3Bg6NnORtflGzx9ZWAltZbjYjjRqegPv0EQNYcHqWo eRpXilEo1ahT6nmOU8V7yEvT2j4wlLcQ6qg7w+N/vcBvyd/weiwHU+vTQ9mT61x5/wUrQhdw 2gJHeQXeDGMJV49RT2EEz+QVxaf477eyWsdQzPVjAKRMT3BVdK8WvpYAEfBAbXmkboOxABEB AAG0HG1pa2UgdGFuY3NhIDxtaWtlQHNlbnRleC5jYT6JATgEEwECACIFAkzcA24CGwMGCwkI BwMCBhUIAgkKCwQWAgMBAh4BAheAAAoJEJXHwM2kc8rX+sMH/2V6pTBKsQ5mpWWLgs6wVP2k BC+6r/YKNXv9Rw/PrC6+9hTbgA+sSjJ+8gxsCbJsOQXZrxF0x3l9oYdYfuKcwdwXFX1/FS8p HfBeDkmlH+dI709xT9wgrR4dS5aMmKp0scPrXPIAKiYVOHjOlNItcLYTEEWEFBepheEVsgmk GrNbcrHwOx/u4igUQ8vcpyXPyUki+BsftPw8ZQvBU887igh0OxaCR8AurJppQ5UQd63r81cX E1ZjoFoWCaGK/SjPb/OhpYpu5swoZIhOxQbn7OtakYPsDd5t2A5KhvjI8BMTnd5Go+2xsCmr jlIEq8Bi29gCcfQUvNiClevi13ifmnm5AQ0ETNwDbgEIALWGNJHRAhpd0A4vtd3G0oRqMBcM FGThQr3qORmEBTPPEomTdBaHcn+Xl+3YUvTBD/67/mutWBwgp2R5gQOSqcM7axvgMSHbKqBL 9sd1LsLw0UT2O5AYxv3EwzhG84pwRg3XcUqvWA4lA8tIj/1q4Jzi5qOkg1zxq4W9qr9oiYK5 bBR638JUvr3eHMaz/Nz+sDVFgwHmXZj3M6aE5Ce9reCGbvrae7H5D5PPvtT3r22X8SqfVAiO TFKedCf/6jbSOedPN931FJQYopj9P6b3m0nI3ZiCDVSqeyOAIBLzm+RBUIU3brzoxDhYR8pz CJc2sK8l6YjqivPakrD86bFDff8AEQEAAYkBHwQYAQIACQUCTNwDbgIbDAAKCRCVx8DNpHPK 1+iQB/99aqNtez9ZTBWELj269La8ntuRx6gCpzfPXfn6SDIfTItDxTh1hrdRVP5QNGGF5wus N4EMwXouskva1hbFX3Pv72csYSxxEJXjW16oV8WK4KjKXoskLg2RyRP4uXqL7Mp2ezNtVY5F 9nu3fj4ydpHCSaqKy5xd70A8D50PfZsFgkrsa5gdQhPiGGEdxhq/XSeAAnZ4uVLJKarH+mj5 MEhgZPEBWkGrbDZpezl9qbFcUem/uT9x8FYT/JIztMVh9qDcdP5tzANW5J7nvgXjska+VFGY ryZK4SPDczh74mn6GI/+RBi7OUzXXPgpPBrhS5FByjwCqjjsSpTjTds+NGIY Organization: Sentex Communications Message-ID: Date: Thu, 18 Jul 2019 16:24:38 -0400 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.7.2 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: base64 Content-Language: en-US X-Rspamd-Queue-Id: F06D27084E X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::18 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.25 / 15.00]; ARC_NA(0.00)[]; RDNS_NONE(1.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.989,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[sentex.net]; RCPT_COUNT_ONE(0.00)[1]; HAS_ORG_HEADER(0.00)[]; IP_SCORE(-1.72)[ipnet: 2607:f3e0::/32(-4.94), asn: 11647(-3.58), country: CA(-0.09)]; TO_DN_ALL(0.00)[]; MX_GOOD(-0.01)[smtp.sentex.ca]; MIME_BASE64_TEXT(0.10)[]; NEURAL_HAM_SHORT(-0.84)[-0.835,0]; NEURAL_HAM_LONG(-0.99)[-0.992,0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; HFILTER_HOSTNAME_UNKNOWN(2.50)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Jul 2019 20:24:55 -0000 SSBoYXZlIGJlZW4gYWRkaW5nIHpmcyByZXBsaWNhdGlvbiB2aWEgYSBncmVhdCBhcHAgY2Fs bGVkIHpyZXBsIGFuZCByYW4NCmludG8gYW4gZXJyb3IgLyBpc3N1ZSBJIGFtIG5vdCAxMDAl IHN1cmUgd2hhdCB0byBtYWtlIG9mLsKgIEl0IG9ubHkNCmhhcHBlbnMgd2hlbiByZXBsaWNh dGlvbiBkYXRhc2V0cyB0aGF0IGFyZSB2b2x1bWVzIHdpdGggbG9uZ2lzaCBuYW1lcw0KDQpP biB0aGUgc291cmNlIHNlcnZlciAoUkVMRU5HMTEgb3IgMTIgKSBpZiBJIGRvDQoNCnpmcyBz ZW5kIC1SdiB6cm9vdC92b2x1bWV0ZXN0QHpyZXBsXzIwMTkwNzE4XzE4NTM0Nl8wMDAgfCBu YyAxMC4xNTEuOS4zIDEwMDANCg0KYW5kIG9uIHRoZSByZWN2IHNlcnZlciBJIGRvDQoNCm5j IC1sIDEwMDAgfCB6ZnMgcmVjdiAtdkYgenJvb3QvMTIzNDU2Nzg5MDEyMzQ1Njc4OTAxMjM0 NTYNCg0KQWxsIGlzIGZpbmUuIFRoZSB2b2x1bWUgY29tZXMgaW4gbm8gcHJvYmxlbS7CoCBJ ZiBpbnN0ZWFkIEkgYWRkIGFuIGV4dHJhIGNoYXINCg0KbmMgLWwgMTAwMCB8IHpmcyByZWN2 IC12RiB6cm9vdC8xMjM0NTY3ODkwMTIzNDU2Nzg5MDEyMzQ1NmENCg0KSSBnZXQgYW4gZXJy b3IgLyB3YXJuaW5nIGluIGRtZXNnDQoNCmdfZGV2X3Rhc3RlOiBtYWtlX2Rldl9wKCkgZmFp bGVkDQooZ3AtPm5hbWU9enZvbC96cm9vdC8xMjM0NTY3ODkwMTIzNDU2Nzg5MDEyMzQ1NmFA enJlcGxfMjAxOTA3MThfMTg1MzQ2XzAwMCwNCmVycm9yPTYzKQ0KDQpJdCBkb2VzbnQgc2Vl bSB0byBiZSB0aGUgbG9uZyBkYXRhc2V0IG5hbWUuIEl0cyB3aGF0IHRoZSBlbnRpcmUgdGhp bmcNCmFkZHMgdXAgdG8uwqANCg0KV2l0aCBhIG5vbiB2b2x1bWUgZGF0YXNldCwgaXRzIE9L IG5vIG1hdHRlciB3aGF0IGdpYW50IG5hbWUvcGF0aCBpdCBhZGRzDQp1cCB0by7CoA0KDQpB bnkgaWRlYXMgd2hhdCBJIGFtIGJ1bXBpbmcgaW50byA/IEkgc2F3IHJlZnMgdG8gZGV2IG5h bWUgbGltaXRzIG9mIDYzDQpjaGFycywgYnV0DQoNCi9kZXYvenZvbC96cm9vdC8xMjM0NTY3 ODkwMTIzNDU2Nzg5MDEyMzQ1Ng0KDQppcyBvbmx5IDQzIGZyb20gdGhlIGZpcnN0IC8gPw0K DQpJdCBzZWVtcyBJIGNhbiBzZW5kIGEgYmlnIGFzcyB6dm9sIHRvIGEgc2VydmVyLCBzZWUg dGhlIGVycm9yIC8gd2FybmluZw0KbWVzc2FnZQ0KDQowKG5mczIpIyB6ZnMgbGlzdCAtdCB2 b2x1bWUNCk5BTUXCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDC oMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDC oMKgwqDCoMKgwqDCoMKgwqAgVVNFRMKgDQpBVkFJTMKgIFJFRkVSwqAgTU9VTlRQT0lOVA0K enJvb3QtbmZzMi96dm9sdGVzdMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDC oMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqDCoMKgwqAgMS43OEfC oMKgDQozNzNHwqDCoCA3NjFNwqAgLQ0KenJvb3QtbmZzMi96dm9sdGVzdDEyMzQ1Njc4OTAx MjM0NTY3ODkwMTIzNDU2Nzg5MDEyMzQ1Njc4OTDCoCAxLjc4R8KgwqANCjM3M0fCoMKgIDc2 MU3CoCAtDQowKG5mczIpIw0KDQphbmQgSSBjYW5ub3Qgc2VlIGl0IGF0DQoNCjAobmZzMikj IGxzIC1sIC9kZXYvenZvbC96cm9vdC1uZnMyLw0KdG90YWwgMQ0KZHIteHIteHIteMKgIDIg cm9vdMKgIHdoZWVswqDCoMKgwqAgLcKgIDUxMiBKdWwgMTggMTU6MTQgLg0KZHIteHIteHIt eMKgIDMgcm9vdMKgIHdoZWVswqDCoMKgwqAgLcKgIDUxMiBKdWwgMTggMTU6MTQgLi4NCmNy dy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhiOCBKdWwgMTggMTU6MTIgenZv bHRlc3QNCmNydy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhiZiBKdWwgMTgg MTU6MTIgenZvbHRlc3RAbWR0dGVzdA0KY3J3LXItLS0tLcKgIDEgcm9vdMKgIG9wZXJhdG9y wqAgLSAweGQ4IEp1bCAxOCAxNToxMiB6dm9sdGVzdEBtZHR0ZXN0Mg0KY3J3LXItLS0tLcKg IDEgcm9vdMKgIG9wZXJhdG9ywqAgLSAweGQ5IEp1bCAxOCAxNToxMiB6dm9sdGVzdEBtZHR0 ZXN0MnAxDQpjcnctci0tLS0twqAgMSByb290wqAgb3BlcmF0b3LCoCAtIDB4YzUgSnVsIDE4 IDE1OjEyIHp2b2x0ZXN0QG1kdHRlc3RwMQ0KY3J3LXItLS0tLcKgIDEgcm9vdMKgIG9wZXJh dG9ywqAgLSAweGM0IEp1bCAxOCAxNToxMiB6dm9sdGVzdHAxDQowKG5mczIpIw0KDQpCdXQg aWYgSSByZW5hbWUgaXQsIGl0cyB0aGVyZSBqdXN0IGZpbmUuDQoNCjAobmZzMikjIHpmcyBy ZW5hbWUNCnpyb290LW5mczIvenZvbHRlc3QxMjM0NTY3ODkwMTIzNDU2Nzg5MDEyMzQ1Njc4 OTAxMjM0NTY3ODkwwqANCnpyb290LW5mczIvenZvbHRlc3QxMjMNCjAobmZzMikjIGxzIC1s IC9kZXYvenZvbC96cm9vdC1uZnMyLw0KdG90YWwgMQ0KZHIteHIteHIteMKgIDIgcm9vdMKg IHdoZWVswqDCoMKgwqAgLcKgIDUxMiBKdWwgMTggMTU6MTQgLg0KZHIteHIteHIteMKgIDMg cm9vdMKgIHdoZWVswqDCoMKgwqAgLcKgIDUxMiBKdWwgMTggMTU6MTQgLi4NCmNydy1yLS0t LS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhiOCBKdWwgMTggMTU6MTIgenZvbHRlc3QN CmNydy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhkZiBKdWwgMTggMTY6MDkg enZvbHRlc3QxMjMNCmNydy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhkZSBK dWwgMTggMTY6MDkgenZvbHRlc3QxMjNAbWR0dGVzdA0KY3J3LXItLS0tLcKgIDEgcm9vdMKg IG9wZXJhdG9ywqAgLSAweGRkIEp1bCAxOCAxNjowOSB6dm9sdGVzdDEyM0BtZHR0ZXN0Mg0K Y3J3LXItLS0tLcKgIDEgcm9vdMKgIG9wZXJhdG9ywqAgLSAweGUwIEp1bCAxOCAxNjowOSB6 dm9sdGVzdDEyM0BtZHR0ZXN0MnAxDQpjcnctci0tLS0twqAgMSByb290wqAgb3BlcmF0b3LC oCAtIDB4ZTEgSnVsIDE4IDE2OjA5IHp2b2x0ZXN0MTIzQG1kdHRlc3RwMQ0KY3J3LXItLS0t LcKgIDEgcm9vdMKgIG9wZXJhdG9ywqAgLSAweGUyIEp1bCAxOCAxNjowOSB6dm9sdGVzdDEy M3AxDQpjcnctci0tLS0twqAgMSByb290wqAgb3BlcmF0b3LCoCAtIDB4YmYgSnVsIDE4IDE1 OjEyIHp2b2x0ZXN0QG1kdHRlc3QNCmNydy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRvcsKg IC0gMHhkOCBKdWwgMTggMTU6MTIgenZvbHRlc3RAbWR0dGVzdDINCmNydy1yLS0tLS3CoCAx IHJvb3TCoCBvcGVyYXRvcsKgIC0gMHhkOSBKdWwgMTggMTU6MTIgenZvbHRlc3RAbWR0dGVz dDJwMQ0KY3J3LXItLS0tLcKgIDEgcm9vdMKgIG9wZXJhdG9ywqAgLSAweGM1IEp1bCAxOCAx NToxMiB6dm9sdGVzdEBtZHR0ZXN0cDENCmNydy1yLS0tLS3CoCAxIHJvb3TCoCBvcGVyYXRv csKgIC0gMHhjNCBKdWwgMTggMTU6MTIgenZvbHRlc3RwMQ0KMChuZnMyKSMNCg0KYW5kIGl0 IHNlZW1zIHRvIGltcG9ydCAvIHdvcmsganVzdCBmaW5lDQowKG5mczIpIyBtb3VudCAvZGV2 L3p2b2wvenJvb3QtbmZzMi96dm9sdGVzdDEyM3AxIC9tbnQNCg0KMChuZnMyKSMgbHMgLWwg L21udA0KdG90YWwgNTgwNDcxDQpkcnd4ci14ci14wqDCoCAzIHJvb3TCoCB3aGVlbMKgwqDC oMKgIC3CoMKgwqDCoMKgwqDCoMKgwqDCoCA1MTIgSnVsIDE4IDE2OjA1IC4NCmRyd3hyLXhy LXjCoCAyMyByb290wqAgd2hlZWzCoMKgwqDCoCB1YXJjaMKgwqDCoMKgwqDCoMKgIDI5IEp1 bCAxNCAxMzo0NyAuLg0KZHJ3eHJ3eHIteMKgwqAgMiByb290wqAgb3BlcmF0b3LCoCAtwqDC oMKgwqDCoMKgwqDCoMKgwqAgNTEyIEp1bCAxOCAxNTowNyAuc25hcA0KLXJ3LXItLXItLcKg wqAgMSByb290wqAgd2hlZWzCoMKgwqDCoCAtwqDCoMKgwqDCoMKgwqDCoMKgwqAgMjA2IEp1 bCAxOCAxNjowNSBtZDUub3V0DQotcnctci0tci0twqDCoCAxIHJvb3TCoCB3aGVlbMKgwqDC oMKgIC3CoMKgwqDCoCAxOTI5NDkyNDggSnVsIDE4IDE1OjA4IHRlc3RmaWxlDQotcnctci0t ci0twqDCoCAxIHJvb3TCoCB3aGVlbMKgwqDCoMKgIC3CoMKgwqDCoMKgIDQ2MzkzMzQ0IEp1 bCAxOCAxNTowOCB0ZXN0ZmlsZTINCi1ydy1yLS1yLS3CoMKgIDEgcm9vdMKgIHdoZWVswqDC oMKgwqAgLcKgwqDCoMKgIDEwOTc5MTIzMiBKdWwgMTggMTU6MDggdGVzdGZpbGUyMw0KLXJ3 LXItLXItLcKgwqAgMSByb290wqAgd2hlZWzCoMKgwqDCoCAtwqDCoMKgwqAgMjQ0OTEyNjQw IEp1bCAxOCAxNTowOCB0ZXN0ZmlsZTIzNA0KMChuZnMyKSMgY2QgL21udA0KMChuZnMyKSMg bWQ1IHRlc3QqDQpNRDUgKHRlc3RmaWxlKSA9IDBhYmVlY2IxOGRiZWNiODVjYTdmM2I0NzY0 ZGI2NzI3DQpNRDUgKHRlc3RmaWxlMikgPSAxMjVhZGYwMTAzMGRjZjY4M2VjZGIxNGZiNTJl OWNiMQ0KTUQ1ICh0ZXN0ZmlsZTIzKSA9IDBhZWE2NGJmZDdjZTI1ZmFjMjIxZTY0ODdjNWQ0 NTEyDQpNRDUgKHRlc3RmaWxlMjM0KSA9IGJhMjY4OWVlYjFjZDAxYWFhNGM2NTEwZGM1MDFh OGUyDQowKG5mczIpIyBjYXQgbWQ1Lm91dA0KTUQ1ICh0ZXN0ZmlsZSkgPSAwYWJlZWNiMThk YmVjYjg1Y2E3ZjNiNDc2NGRiNjcyNw0KTUQ1ICh0ZXN0ZmlsZTIpID0gMTI1YWRmMDEwMzBk Y2Y2ODNlY2RiMTRmYjUyZTljYjENCk1ENSAodGVzdGZpbGUyMykgPSAwYWVhNjRiZmQ3Y2Uy NWZhYzIyMWU2NDg3YzVkNDUxMg0KTUQ1ICh0ZXN0ZmlsZTIzNCkgPSBiYTI2ODllZWIxY2Qw MWFhYTRjNjUxMGRjNTAxYThlMg0KMChuZnMyKSMNCg0KU28gYXBhcnQgZnJvbSBqdXN0IHRo ZSBsaW1pdCBvZiBub3QgYmVpbmcgYWJsZSB0byBhY2Nlc3MgdGhlIHZvbHVtZQ0KZnJvbcKg IC9kZXYvenZvbCB3aXRob3V0IHJlbmFtaW5nIGl0IHRvIHNvbWV0aGluZyBzbWFsbGVyLCBp cyB0aGVyZQ0KYW55dGhpbmcgSSBuZWVkIHRvIHdvcnJ5IGFib3V0ID8NCg0KwqDCoMKgIC0t LU1pa2UNCg0KLS0gDQotLS0tLS0tLS0tLS0tLS0tLS0tDQpNaWtlIFRhbmNzYSwgdGVsICsx IDUxOSA2NTEgMzQwMCB4MjAzDQpTZW50ZXggQ29tbXVuaWNhdGlvbnMsIG1pa2VAc2VudGV4 Lm5ldA0KUHJvdmlkaW5nIEludGVybmV0IHNlcnZpY2VzIHNpbmNlIDE5OTQgd3d3LnNlbnRl eC5uZXQNCkNhbWJyaWRnZSwgT250YXJpbyBDYW5hZGEgICANCg0K From owner-freebsd-questions@freebsd.org Fri Jul 19 00:04:50 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A42A1B4C90 for ; Fri, 19 Jul 2019 00:04:50 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene.sentex.ca (unknown [IPv6:2607:f3e0:0:3::18]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "pyroxene.sentex.ca", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id C1B9C77D03 for ; Fri, 19 Jul 2019 00:04:49 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [192.168.43.26] ([192.168.43.26]) by pyroxene.sentex.ca (8.15.2/8.15.2) with ESMTP id x6J04ljS044812; Thu, 18 Jul 2019 20:04:47 -0400 (EDT) (envelope-from mike@sentex.net) Subject: Re: zfs recv errors (g_dev_taste: make_dev_p() failed) From: Mike Tancsa To: freebsd-questions References: Openpgp: preference=signencrypt Autocrypt: addr=mike@sentex.net; prefer-encrypt=mutual; keydata= mQENBEzcA24BCACpwI/iqOrs0GfQSfhA1v6Z8AcXVeGsRyKEKUpxoOYxXWc2z3vndbYlIP6E YJeifzKhS/9E+VjhhICaepLHfw865TDTUPr5D0Ed+edSsKjlnDtb6hfNJC00P7eoiuvi85TW F/gAxRY269A5d856bYrzLbkWp2lKUR3Bg6NnORtflGzx9ZWAltZbjYjjRqegPv0EQNYcHqWo eRpXilEo1ahT6nmOU8V7yEvT2j4wlLcQ6qg7w+N/vcBvyd/weiwHU+vTQ9mT61x5/wUrQhdw 2gJHeQXeDGMJV49RT2EEz+QVxaf477eyWsdQzPVjAKRMT3BVdK8WvpYAEfBAbXmkboOxABEB AAG0HG1pa2UgdGFuY3NhIDxtaWtlQHNlbnRleC5jYT6JATgEEwECACIFAkzcA24CGwMGCwkI BwMCBhUIAgkKCwQWAgMBAh4BAheAAAoJEJXHwM2kc8rX+sMH/2V6pTBKsQ5mpWWLgs6wVP2k BC+6r/YKNXv9Rw/PrC6+9hTbgA+sSjJ+8gxsCbJsOQXZrxF0x3l9oYdYfuKcwdwXFX1/FS8p HfBeDkmlH+dI709xT9wgrR4dS5aMmKp0scPrXPIAKiYVOHjOlNItcLYTEEWEFBepheEVsgmk GrNbcrHwOx/u4igUQ8vcpyXPyUki+BsftPw8ZQvBU887igh0OxaCR8AurJppQ5UQd63r81cX E1ZjoFoWCaGK/SjPb/OhpYpu5swoZIhOxQbn7OtakYPsDd5t2A5KhvjI8BMTnd5Go+2xsCmr jlIEq8Bi29gCcfQUvNiClevi13ifmnm5AQ0ETNwDbgEIALWGNJHRAhpd0A4vtd3G0oRqMBcM FGThQr3qORmEBTPPEomTdBaHcn+Xl+3YUvTBD/67/mutWBwgp2R5gQOSqcM7axvgMSHbKqBL 9sd1LsLw0UT2O5AYxv3EwzhG84pwRg3XcUqvWA4lA8tIj/1q4Jzi5qOkg1zxq4W9qr9oiYK5 bBR638JUvr3eHMaz/Nz+sDVFgwHmXZj3M6aE5Ce9reCGbvrae7H5D5PPvtT3r22X8SqfVAiO TFKedCf/6jbSOedPN931FJQYopj9P6b3m0nI3ZiCDVSqeyOAIBLzm+RBUIU3brzoxDhYR8pz CJc2sK8l6YjqivPakrD86bFDff8AEQEAAYkBHwQYAQIACQUCTNwDbgIbDAAKCRCVx8DNpHPK 1+iQB/99aqNtez9ZTBWELj269La8ntuRx6gCpzfPXfn6SDIfTItDxTh1hrdRVP5QNGGF5wus N4EMwXouskva1hbFX3Pv72csYSxxEJXjW16oV8WK4KjKXoskLg2RyRP4uXqL7Mp2ezNtVY5F 9nu3fj4ydpHCSaqKy5xd70A8D50PfZsFgkrsa5gdQhPiGGEdxhq/XSeAAnZ4uVLJKarH+mj5 MEhgZPEBWkGrbDZpezl9qbFcUem/uT9x8FYT/JIztMVh9qDcdP5tzANW5J7nvgXjska+VFGY ryZK4SPDczh74mn6GI/+RBi7OUzXXPgpPBrhS5FByjwCqjjsSpTjTds+NGIY Organization: Sentex Communications Message-ID: <11b29926-f34f-99cd-e0d0-e1b1339f0f3f@sentex.net> Date: Thu, 18 Jul 2019 20:04:45 -0400 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.7.2 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: C1B9C77D03 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::18 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.46 / 15.00]; ARC_NA(0.00)[]; RDNS_NONE(1.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.987,0]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[sentex.net]; RCPT_COUNT_ONE(0.00)[1]; HAS_ORG_HEADER(0.00)[]; IP_SCORE(-1.72)[ipnet: 2607:f3e0::/32(-4.94), asn: 11647(-3.58), country: CA(-0.09)]; TO_DN_ALL(0.00)[]; MX_GOOD(-0.01)[cached: smtp.sentex.ca]; NEURAL_HAM_SHORT(-0.95)[-0.946,0]; NEURAL_HAM_LONG(-0.99)[-0.989,0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; MID_RHS_MATCH_FROM(0.00)[]; HFILTER_HOSTNAME_UNKNOWN(2.50)[]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 00:04:50 -0000 On 7/18/2019 4:24 PM, Mike Tancsa wrote: > I have been adding zfs replication via a great app called zrepl and ran > into an error / issue I am not 100% sure what to make of.  It only > happens when replication datasets that are volumes with longish names .... > I get an error / warning in dmesg > > g_dev_taste: make_dev_p() failed > (gp->name=zvol/zroot/12345678901234567890123456a@zrepl_20190718_185346_000, > error=63) On the target server being replicated to, doing a zfs set volmode=none works around the issue of the OS trying to make a dev in /dev/zvol... One caveat, as when doing a restore I guess that will need to be unset.  Not sure if bhyve disks need a value other than none to work or not.      ---Mike -- ------------------- Mike Tancsa, tel +1 519 651 3400 x203 Sentex Communications, mike@sentex.net Providing Internet services since 1994 www.sentex.net Cambridge, Ontario Canada From owner-freebsd-questions@freebsd.org Fri Jul 19 11:43:01 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 744E8BF89F for ; Fri, 19 Jul 2019 11:43:01 +0000 (UTC) (envelope-from stringchopper@gmail.com) Received: from mail-pf1-x42e.google.com (mail-pf1-x42e.google.com [IPv6:2607:f8b0:4864:20::42e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 6E05C6A5B9 for ; Fri, 19 Jul 2019 11:43:00 +0000 (UTC) (envelope-from stringchopper@gmail.com) Received: by mail-pf1-x42e.google.com with SMTP id r7so14076597pfl.3 for ; Fri, 19 Jul 2019 04:43:00 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=BaW0JscrJOeyf2+WvypVwjcrL7FqhZIhUED5VFjHNvY=; b=ZT/yAsrIha23Q42eIp2klA7cWxSK1EBir8qxOKcqfmSvyOEkvLZ/jA1QeRLiOfrCFe h7kfdwtdNDehP9w9ng/F4vvk4KDoQdZobWTRwQWGfosDjyhXmkH+dT8w8v6EneQsWbtp Al9r0En+Q9Fb2/iXXJREFI3i8rsrebhtW4hWj7UDwEJL75oj7fEwjL4v7CXLC4wfgcF5 LQEuZYn43gY5BIxj42wq/xadLv0TewPy3LIBxtJfepOSMzdBHGm1/kwCoard+CgPZaYY Re1n8H+gG7ZwZVm8g30DR5SOQJ1OlBQLjm/KpOFaAPjnHoCP8wj9i62JpgIrxKwU9AUw v6QQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=BaW0JscrJOeyf2+WvypVwjcrL7FqhZIhUED5VFjHNvY=; b=ad8kt15WVrlcnFwUlaGWkmBmrApzz8DoyasoQ3rNvdyUB4wBiPd6Nb8ixcAh3gnzF0 YoDk/RNyicDMgQiIg8Ox641ZzRjorMNJk9GGjmXj1SxSSNyjcx/SAW1W00mexxKTTebH 8AytGAV/sCUx6lE2P3wTH7OswuqkXRflQi6TIeE8hKifovs0G+BaXeu54CAh4J0l8BlM YjoateMply3+M8gaKtH9EYx43yQO53rEXUxPOmqOHsLukWHarMYOsSGZdzahBOCfvAwu 6rz6thrzW+qIEtOO3JykKciZtTCxxM4idzKlWtH1l7iGdkfuOamSATjItSR80p9m+9J8 poLA== X-Gm-Message-State: APjAAAX63hXTs5NidunyQ9roPATVDEMXd8m9Magtysc7mAdMSNN0Fa4N Q64xA58d9Yi/Rb98FiiCJhVjHKWMnwRMMZJSlv5U3Crg2os= X-Google-Smtp-Source: APXvYqxOuROYePiLL4iP5Znzp2nJ1of50qPVkeEUaukSsRnv4tiuAYrXuTa2oSGp1TYWby7OCsL23KZd4RkKbAJigPk= X-Received: by 2002:a17:90a:d996:: with SMTP id d22mr57378155pjv.86.1563536578742; Fri, 19 Jul 2019 04:42:58 -0700 (PDT) MIME-Version: 1.0 From: Brian Phillips Date: Fri, 19 Jul 2019 07:42:22 -0400 Message-ID: Subject: .emacs error in developer's handbook (section 2.7) standard-display-european & cannot load hilit19 To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 6E05C6A5B9 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=ZT/yAsrI; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of stringchopper@gmail.com designates 2607:f8b0:4864:20::42e as permitted sender) smtp.mailfrom=stringchopper@gmail.com X-Spamd-Result: default: False [-6.91 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; RCVD_IN_DNSWL_NONE(0.00)[e.2.4.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.b.8.f.7.0.6.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-2.94)[ip: (-9.11), ipnet: 2607:f8b0::/32(-3.13), asn: 15169(-2.43), country: US(-0.05)]; NEURAL_HAM_SHORT(-0.96)[-0.959,0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 11:43:01 -0000 I'm trying to use the .emacs configuration listed in the FreeBSD Developer's Handbook, 2.7, and I get these error messages for which google isn't helping (this neophyte) much. Can someone point me in the right direction for fixing the 'standard-display-european' issue as well as the 'cannot open load file ... hilit19' problem? ----------------------------------- Warning (i18n): =E2=80=98standard-display-european=E2=80=99 is semi-obsolet= e; see its doc string for details Warning (initialization): An error occurred while loading =E2=80=98/home/brian/.emacs=E2=80=99: File is missing: Cannot open load file, No such file or directory, hilit19 To ensure normal operation, you should investigate and remove the cause of the error in your initialization file. Start Emacs with the =E2=80=98--debug-init=E2=80=99 option to view a complete error backtrac= e. ----------------------------------- debug-init looks like this: ----------------------------------- Debugger entered--Lisp error: (file-missing "Cannot open load file" "No such file or directory" "hilit19") require(hilit19) (progn (setq hilit-mode-enable-list '(not text-mode c-mode c++-mode emacs-lisp-mode lisp-mode scheme-mode) hilit-auto-highlight nil hilit-auto-rehighlight 'visible hilit-inhibit-hooks nil hilit-inhibit-rebinding t) (require 'hilit19) (require 'paren)) (if window-system (progn (setq hilit-mode-enable-list '(not text-mode c-mode c++-mode emacs-lisp-mode lisp-mode scheme-mode) hilit-auto-highlight nil hilit-auto-rehighlight 'visible hilit-inhibit-hooks nil hilit-inhibit-rebinding t) (require 'hilit19) (require 'paren)) (setq baud-rate 2400)) eval-buffer(# nil "/home/brian/.emacs" nil t) ; Reading at buffer position 7899 load-with-code-conversion("/home/brian/.emacs" "/home/brian/.emacs" t t) load("~/.emacs" t t) #f(compiled-function () #)() command-line() normal-top-level() ----------------------------------- Kind regards, Brian Paul Phillips From owner-freebsd-questions@freebsd.org Fri Jul 19 12:43:11 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E6C2CA1F4F for ; Fri, 19 Jul 2019 12:43:11 +0000 (UTC) (envelope-from vas@mpeks.tomsk.su) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 32E826BF82 for ; Fri, 19 Jul 2019 12:43:10 +0000 (UTC) (envelope-from vas@mpeks.tomsk.su) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=Message-ID:Subject:To:From:Date:In-Reply-To; bh=OiFXvg5c7GEzGV+LuFc6B4q0uDZlbVo2g8cOjd2ny9I=; b=XRSRQbfWIf8xB4JOulQMq+LMp0 Be+0KngBmcGg/0+1fcywykcPgVLAAMT6YmN3V/0IigHxLSjWbakYibZsFGWqGG85Y4eoQKQNXSE9y cLoTA8RWGPYiNHyYaWCdqNHIZPGtwVOQFjoPrtr+FrHM+8FM163nPWIHUyaqxSmUMdG8=; Received: from vas by admin.sibptus.ru with local (Exim 4.92 (FreeBSD)) (envelope-from ) id 1hoSE9-0007vX-Gd for freebsd-questions@freebsd.org; Fri, 19 Jul 2019 19:43:09 +0700 Date: Fri, 19 Jul 2019 19:43:09 +0700 From: Victor Sudakov To: freebsd-questions@freebsd.org Subject: The quality of NFSv4 ACLs on ZFS? Message-ID: <20190719124309.GA30285@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="MGYHOYXEY6WxJCY8" Content-Disposition: inline X-PGP-Key: http://www.dreamwidth.org/pubkey?user=victor_sudakov X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 User-Agent: Mutt/1.12.1 (2019-06-15) Sender: Victor Sudakov X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 12:43:12 -0000 --MGYHOYXEY6WxJCY8 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dear Colleagues, I see that in FreeBSD systems installed on ZFS, NFSv4 ACLs are enabled out of the box. At least getfacl shows their presence on every file of the system. Are they reliable and production-ready? Can I use them for real fine-grained file access control to important files?=20 What should I enable in net/samba48 for the FreeBSD SMB file server to present them to Windows clients? --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --MGYHOYXEY6WxJCY8 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJdMbrdAAoJEA2k8lmbXsY0kS8H/0imQUQNR1tge1xklypBSMZR zlQDzHzEnhqhzlZxP6SS29Gp0SCl8ElUYg0jsZGjMw3lP5ye8hUEcYSBJdAR3hdr 3gXeqJevqkOnt1UZzriCheDXNsBShDhI6D6CEh/3AkaR/iUAev69If6M6rnLseTI KOkdq8LMou86Hc5Tt8inVn/0EaP5flIsM2M6Rz3iWPsiEJR004QBT1/7OhuV/34K yW386+ecRyn4C3fmszQRdYipS2chwpjk2IzeLKisncI/NBFHXQhja/XHuvlxela4 BKrz62fVtSilHalHhodyNv3AKxv2zEt/AkGDpfR92rYPtpppoNdfPrZnnTDvO94= =N5Ii -----END PGP SIGNATURE----- --MGYHOYXEY6WxJCY8-- From owner-freebsd-questions@freebsd.org Fri Jul 19 13:37:00 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9CE4EA2DAF for ; Fri, 19 Jul 2019 13:37:00 +0000 (UTC) (envelope-from freebsd-questions-local@be-well.ilk.org) Received: from be-well.ilk.org (be-well.ilk.org [23.30.133.173]) by mx1.freebsd.org (Postfix) with ESMTP id 2778D6D7F5 for ; Fri, 19 Jul 2019 13:37:00 +0000 (UTC) (envelope-from freebsd-questions-local@be-well.ilk.org) Received: by be-well.ilk.org (Postfix, from userid 1147) id 492E233C25; Fri, 19 Jul 2019 09:27:26 -0400 (EDT) From: Lowell Gilbert To: Brian Phillips Cc: freebsd-questions@freebsd.org Subject: Re: .emacs error in developer's handbook (section 2.7) standard-display-european & cannot load hilit19 References: Reply-To: freebsd-questions@freebsd.org Date: Fri, 19 Jul 2019 09:27:25 -0400 In-Reply-To: (Brian Phillips's message of "Fri, 19 Jul 2019 07:42:22 -0400") Message-ID: <44r26mnohu.fsf@be-well.ilk.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/26.2 (berkeley-unix) MIME-Version: 1.0 Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 2778D6D7F5 X-Spamd-Bar: ++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [2.57 / 15.00]; ARC_NA(0.00)[]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_SPAM_SHORT(0.29)[0.287,0]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[ilk.org]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.65)[0.648,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MX_GOOD(-0.01)[cached: be-well.ilk.org]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_SPAM_LONG(0.57)[0.574,0]; R_SPF_NA(0.00)[]; FREEMAIL_TO(0.00)[gmail.com]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7922, ipnet:23.30.0.0/15, country:US]; MID_RHS_MATCH_FROM(0.00)[]; IP_SCORE(0.07)[ip: (0.15), ipnet: 23.30.0.0/15(0.10), asn: 7922(0.15), country: US(-0.05)]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 13:37:00 -0000 Brian Phillips writes: > I'm trying to use the .emacs configuration listed in the FreeBSD > Developer's Handbook, 2.7, and I get these error messages for which google > isn't helping (this neophyte) much. Can someone point me in the right > direction for fixing the 'standard-display-european' issue as well as the > 'cannot open load file ... hilit19' problem? > > ----------------------------------- > Warning (i18n): =91standard-display-european=92 is semi-obsolete; see its= doc > string for details > Warning (initialization): An error occurred while loading > =91/home/brian/.emacs=92: > > File is missing: Cannot open load file, No such file or directory, hilit19 > > To ensure normal operation, you should investigate and remove the > cause of the error in your initialization file. Start Emacs with > the =91--debug-init=92 option to view a complete error backtrace. > ----------------------------------- It looks like hilit19 isn't part of emacs any more. I'm a heavy emacs user, but I never used it, so I can't really advise on what should replace it in the sample emacs configuration you mention. Removing the whole "(if window-system" clause would probably be reasonable for now. Be well. From owner-freebsd-questions@freebsd.org Fri Jul 19 16:27:27 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8CE15A668F for ; Fri, 19 Jul 2019 16:27:27 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from corvid.alerce.com (corvid.alerce.com [206.125.171.163]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 7D1D574A11 for ; Fri, 19 Jul 2019 16:27:26 +0000 (UTC) (envelope-from hartzell@alerce.com) Received: from postfix.alerce.com (76-226-160-236.lightspeed.sntcca.sbcglobal.net [76.226.160.236]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by corvid.alerce.com (Postfix) with ESMTPSA id 4981134610; Fri, 19 Jul 2019 09:27:18 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=alerce.com; s=dkim; t=1563553638; h=from:from:reply-to:reply-to:subject:subject:date:date: message-id:message-id:to:to:cc:cc:mime-version:mime-version: content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=7DRQSEyRhgbN62xc8nG6Dn7qUGTk8EOMHGNuHvCUcaI=; b=U6og8yyx3whupSPUIJ0mEYF2+gEPIzvk77RIHxzu1O//jZitQ2dhhth7lL8oWfNh89QjDw /62CqBSPVOqSLz5+y2w5dojjZOTDPBxt1PtFImfpqVdXfgHIYn+128EmhhP7BWAh3dkKhx xxWYQI5Jnc5y1uRYzwWdAm3OpAzhCvU+9LLpNKlbIFtjZF2nXpYbvIpoxa0xRvopE3uuEs 0CUNG+TCJ7XhvX9LerreOoyHFB6VffKWSSbVBm9qNsSkwuW2BeUtlG2XRpW1yu2wIc/Phx QPLa/jWfFsr2ZbIUteBjrhhGotGA0HSq4YSVM4ay8wnIw7hhXkFpA5nwDFHt+Q== Received: by postfix.alerce.com (Postfix, from userid 501) id 1C9AC201024307; Fri, 19 Jul 2019 09:27:18 -0700 (PDT) From: George Hartzell MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <23857.61286.9721.989244@alice.local> Date: Fri, 19 Jul 2019 09:27:18 -0700 To: Brian Phillips Cc: freebsd-questions@freebsd.org Subject: Re: .emacs error in developer's handbook (section 2.7) standard-display-european & cannot load hilit19 In-Reply-To: References: X-Mailer: VM undefined under 26.1 (x86_64-apple-darwin14.5.0) Reply-To: hartzell@alerce.com X-Rspamd-Queue-Id: 7D1D574A11 X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=alerce.com header.s=dkim header.b=U6og8yyx; dmarc=pass (policy=none) header.from=alerce.com; spf=pass (mx1.freebsd.org: domain of hartzell@alerce.com designates 206.125.171.163 as permitted sender) smtp.mailfrom=hartzell@alerce.com X-Spamd-Result: default: False [-5.23 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[alerce.com:s=dkim]; HAS_REPLYTO(0.00)[hartzell@alerce.com]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; URI_HIDDEN_PATH(1.00)[https://github.com/sjrmanning/.emacs.d]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; NEURAL_HAM_SHORT(-0.96)[-0.964,0]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[alerce.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[alerce.com,none]; MX_GOOD(-0.01)[corvid.alerce.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:25795, ipnet:206.125.168.0/21, country:US]; IP_SCORE(-2.26)[ip: (-6.47), ipnet: 206.125.168.0/21(-4.47), asn: 25795(-0.28), country: US(-0.05)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 16:27:27 -0000 Brian Phillips writes: > I'm trying to use the .emacs configuration listed in the FreeBSD > Developer's Handbook, 2.7, and I get these error messages for which google > isn't helping (this neophyte) much. Can someone point me in the right > direction for fixing the 'standard-display-european' issue as well as the > 'cannot open load file ... hilit19' problem? Looks like that section of the handbook is fairly out of date. Question 66 in the emacs FAQ [1] says that it's deprecated but included; I don't even see it in the current distributions. The same FAQ question goes to describe how to use font-lock mode instead. If you're looking for a good place to get started with a fancier emacs config, I found sjrmanning's config [2] to be a wonderful starting point. g. [1]: http://www.faqs.org/faqs/GNU-Emacs-FAQ/part2/ [2]: https://github.com/sjrmanning/.emacs.d From owner-freebsd-questions@freebsd.org Fri Jul 19 17:17:17 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0F424A762C for ; Fri, 19 Jul 2019 17:17:17 +0000 (UTC) (envelope-from galtsev@astro.uchicago.edu) Received: from astro.uchicago.edu (astro.uchicago.edu [128.135.20.55]) by mx1.freebsd.org (Postfix) with ESMTP id 8672B76827 for ; Fri, 19 Jul 2019 17:17:16 +0000 (UTC) (envelope-from galtsev@astro.uchicago.edu) Received: from point.uchicago.edu (point.uchicago.edu [128.135.52.6]) (Authenticated sender: galtsev) by astro.uchicago.edu (Postfix) with ESMTPSA id B39829CC32 for ; Fri, 19 Jul 2019 12:17:10 -0500 (CDT) To: FreeBSD Mailing List From: Valeri Galtsev Subject: poudriere: build one package (accept license) Message-ID: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> Date: Fri, 19 Jul 2019 12:17:10 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 8672B76827 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dmarc=fail reason="" header.from=uchicago.edu (policy=none) X-Spamd-Result: default: False [-1.48 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_ALL(0.00)[]; MX_GOOD(-0.01)[astro.uchicago.edu]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.88)[-0.885,0]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.991,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-0.01)[country: US(-0.05)]; NEURAL_SPAM_SHORT(0.32)[0.315,0]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 17:17:17 -0000 Dear All, After several years if seamlessly using poudriere, I hit the snag I can not resolve myself. One of the packages requires to accept license the moment it is built. When I do poudriere bulk .... podriere just skips the package saying: Ignored: License DCC needs confirmation, but BATCH is defined Reading man page didn't help me (I suspect I'm just too dumb). I didn't find it at all it is possible to build single package. Attempting to build with either "-i" or "-I" flags didn't help either. Could someone point me in right direction? Thanks in advance to all who will answer! Valeri ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Fri Jul 19 17:21:50 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A5289A789D for ; Fri, 19 Jul 2019 17:21:50 +0000 (UTC) (envelope-from erwan@rail.eu.org) Received: from mail.rail.eu.org (mail.rail.eu.org [IPv6:2001:bc8:30d3:ff17::2]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4868876B63 for ; Fri, 19 Jul 2019 17:21:50 +0000 (UTC) (envelope-from erwan@rail.eu.org) Received: from [192.168.1.14] (lfbn-1-5199-188.w90-105.abo.wanadoo.fr [90.105.169.188]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) (Authenticated sender: erwan) by mail.rail.eu.org (Postfix) with ESMTPSA id 4BB4A7D56 for ; Fri, 19 Jul 2019 19:21:39 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=rail.eu.org; s=mail; t=1563556899; bh=v2dD0J+DvP1EukLi1OQWEh0rrF94gZA0uf/GkwAq794=; h=Subject:To:References:From:Date:In-Reply-To:From; b=s3Br7OoRKMNTZSFrYtR2nPDwWp8F/SBF9XKFb2+CGFxD4lAj413ebr5JP8Lad3xLi 2hIcfPt4puJjvTwqv0zxMkDHYYuX2QsH6nxKLpAXHWVvS5blJ6Q2B9ImGtuI1575Te 5Dq+LS4FaBoiW3q46GGJ7jmBcKoFThv2HRoUgDow= Subject: Re: poudriere: build one package (accept license) To: freebsd-questions@freebsd.org References: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> From: Erwan David Openpgp: id=CAB1220E04DDF6E9CF0CD5C9B80EAC15E40FFD0F Autocrypt: addr=erwan@rail.eu.org; keydata= mQINBFJAaOMBEADAHsjODUMNImClvj0eAW7oCKr/cjccRts2DVrslhb6UEDbxgvnCKGtRy2P A9NcILX/+lG9zaoPw0caDSXDuubrC/giKZAphUTSmd+Uqz+9WDtU602WQuP5d5S1aAUe+fzT 6l9iDSR8Fz07ajjZ791Q0P1P4EwWQDbCJvmNXAknwysX0fIAlLpDaIQ0Asa6IvG/v8TyLZSE U0NytwIfHJMJk5btrM4fdaGc+4XnTK0E2Oa+Qjab18fsBLtHGctQUrDjrWvnGj1slHrfhUrT 67e9NHZgDPmEsOeCChd1ZWurIR0AQFp/Wrz80abJltk+aFswEzOvhkriOGjt4gM31BocpNbZ +sEEg9M6skAeXvuISkfS0bCM3kZ6MgywHE98AbA+8WxiKMRKuuuTNSEmIIRQt8dn7ad/1+r1 KAZ1bkB2naCDArqnpeDb65+378qh/2J6/M0UivSMFLzxXc+AyIxucjmrK8VCWQbDwUiA6sPU W4BC7V7+5j7ELzh4JzQX2LisNzPOqkaTVTfmCgDeL7V9LZErtLlG1rYbISrLvDnWNdiJ9l1d flxnhCs4oqn8KA5DtV6HNwIW6b6zwEHFoDPwtK2fctj0VIRwjiIMlyrEWHiC5NZoPyfexGlj RNP7oaDb6PIItgnBItWq/ZRymXP9gA945DjnrozsUZ02y7OMjQARAQABtB9FcndhbiBEYXZp ZCA8ZXJ3YW5AcmFpbC5ldS5vcmc+iQJUBBMBCAA+AhsDBQsJCAcDBRUKCQgLBRYDAgEAAh4B AheAFiEEyrEiDgTd9unPDNXJuA6sFeQP/Q8FAlzBWT8FCRPm8dwACgkQuA6sFeQP/Q+Ikw/+ Img88okG/yRMOXScYx2/xzr85kpoWJ2k6Pl5w23zZ3oHflMGqXfp5mVQbq2X7MRx/CJwvBcK BAOPe2xVPLh26AlCOI+ZY/cM7HtnKPhIGRqTVi6K8wRE2HSpusVTP9sIt3V7oudYawJq/3KG zRsLXQb4FzvZxE+WXEB1NOHYZsH9A/gG1ljsTAux0Gh6RFp+Ij904YzFyh2gSRTpcSmyotXA X+ur/Cp4fPxCgIKP5evT0Nnq+LUwUoYjhHh73VubdmhouXa4EHQnBtGpuAyRDYnu0GPO2Oo6 Zudsin1MKbYdfwwKo2be7XQa2L1Xx3eavwseJqAAYucKxEQtiqenRWV40Av18Jkv17g0ao3L 0vtoKViljOJgL1Ny8436b6oLJzyNOby0OWHbRjp1l/RYfVYXW2wlF5XzLUMBclZX1fSjheoK vCewHoiRl9XPA+Y4RXMfHRRRFqTt3rkt8A7FBnVXePqwCl63FJ7Ywap60UIsUkXqI2fv5COH eduWKzLvwK22KaaleDadxDgRT7uJSS1XVIjUhkNgrqVMhfoo3yS6qi4+7baGVSrjYRLOp8IO bBtxuNPaQw+/R6BsLC0qacCV0FFY7k22aaKl1WoMNkzY38hyxOPp2VHLtwIGGhY8hHicQUsu KTkF0e24LM5x0Qd7/YyckRDN3FxM6wEYANu5Ag0EUkBo4wEQAL6D44lG/kjEQCY17c5qoeIK RMgR2ZUC6Mx2wPjhawaxRoiDE6EYEt7A5S1KEx+VXDClRnj0DrnCC5UqWsKq0443p3SploIq oCU9yaUe5sfutwCb3SWl2Ae9sAb09RIgdS41Hhg1U1TctIPjLy+0A9qtTopqPZi3ffE+RcJG RDJbJO9e8FiGIkGayruqmvFGJ7lOyK806FJJduDdLbK/l9G3tvxglvrAoPfjxPMPqUACk4t+ 5Gaiu56Kdzf+Fh6hk5UJSV5ETj5FLes+eQgwqa0cPbVsbxZ93Q3ZXBCRTJVP7V34cGjGEeqR ikmceoLJ3Z0erpPY6xn8uHP0AWTh+8g5IlGnt+nfwqPvQcCOBpQGEWIX5Olb52w9J6/TrowV u0aK4XjMuEKRt+ggHwmE6oGGwMppMsEOZXkMOMOJt5hStJ2XcNljH5lWFKL+JyuPJVjOZTt/ wbOk2xtUANAZdsGhQcrkkUx961PVAz4fo+8LDX4eRVLvuFUTJgRaMzlh6EQkgCzprYrZUHa2 5/+GTMygk6kG1cEn10gENAT4g9Gmq6FCExQERg5fZDwC5sxNVPqBa54zyXGGJ+4gReJglFsj xHPKgTaebVTMkwYhVR8UeAMb/yBzpsTD5dr0+Fc7VnmBs5rjqR8bnnx0agJ0HkIB9efAw5tl gwNbVUo5OaUvABEBAAGJAh8EGAEIAAkFAlJAaOMCGwwACgkQuA6sFeQP/Q8A7g//RF2nU4xm n9jlmP1YhiJ6Kx72ODpDVONAujNJ3i71RcGS84pTwedHm8VaOI9hH1eSIxM4AM+hFmruTw65 PR0aziUjMZRsZ112GgiC6UyzfAUIQ1ypjty6rpE1P8C2G2WNNuEwAnr6OiTZA4kim9YmF1FQ y61dbAbajJaFA/SABMu8WJW/YXVYtxHgGW7KLj9LHfnWmbkDz1ECBJsh76PeHavsqhRTHfp7 JWFmsVsxViJT4sr+HkiDfTDuT4k1Ba8Kj3yscsntyNH1l8G/YbDdsfHEhDmsYCLrGb/fUm+p C4DT4+ygLSCJkI1/elKiUpOmOuMgu5xieWhXaWKQa73zsdShhuyRa74MPA8WjkLyDRlb8cGv J5cwsjwnidHE2gYqZETGSGuZDoTPUb5kc2XEKwg1eLuL67acYllzp2epAOAbXn2RahZJPUNX D9MKacByetKBAusXNi4AszxcBqFEHpG4/t3stLmXIDd5LvUayovHd1steHbEPvl9dpU36Fte cnUNO6Z9JhIvAYy8b/7TT61qwQvOsca+NMlS/q+hPkx3npI1GFEAkanFLrLVE1MGT6C0kZ2M Em7mCpZQIZT2IhMsHXhaMQlP5np5/mFJ915bd+B3usfoQNWJmN3g7tVZGvl5Z7m7J5Zv3L84 U13tbPt33blV8WK4hIDA/c/rm2k= Message-ID: <07070bdc-8a4a-95bf-fe18-17618fa31284@rail.eu.org> Date: Fri, 19 Jul 2019 19:21:39 +0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 In-Reply-To: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Content-Language: fr X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 17:21:50 -0000 Le 19/07/2019 à 19:17, Valeri Galtsev a écrit : > Dear All, > > After several years if seamlessly using poudriere, I hit the snag I > can not resolve myself. > > One of the packages requires to accept license the moment it is built. > When I do > > poudriere bulk .... > > podriere just skips the package saying: > > Ignored: License DCC needs confirmation, but BATCH is defined > > Reading man page didn't help me (I suspect I'm just too dumb). I > didn't find it at all it is possible to build single package. > Attempting to build with either "-i" or "-I" flags didn't help either. > Could someone point me in right direction? > > Thanks in advance to all who will answer! > > Valeri > poudriere bulk -j buils only one port. But I do not know whether it will be considered BATCH also. There may also be an option for the port to accept the license before build ? From owner-freebsd-questions@freebsd.org Fri Jul 19 17:53:01 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 82A10A7F74 for ; Fri, 19 Jul 2019 17:53:01 +0000 (UTC) (envelope-from trond.endrestol@ximalas.info) Received: from enterprise.ximalas.info (enterprise.ximalas.info [IPv6:2001:700:1100:1::8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ximalas.info", Issuer "Hostmaster ximalas.info" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 059B8779B7 for ; Fri, 19 Jul 2019 17:53:00 +0000 (UTC) (envelope-from trond.endrestol@ximalas.info) Received: from enterprise.ximalas.info (Ximalas@localhost [127.0.0.1]) by enterprise.ximalas.info (8.15.2/8.15.2) with ESMTPS id x6JHqrWd032224 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Fri, 19 Jul 2019 19:52:53 +0200 (CEST) (envelope-from trond.endrestol@ximalas.info) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=ximalas.info; s=default; t=1563558774; bh=JcXHYkt2hj7+hMVw7ZaUv2VM58bCZj/eQyoBeMONbKk=; h=Date:From:To:Subject:In-Reply-To:References; b=fgkJOJOsnpYY8qPcaXQzIwh65t+yurz62O8bk0sAtqfr0RbdeQhKGzk2J8KqBeXaJ f2QSWFtjUDYB2Ao3596mvEavYfiNvdhhGpYZVMMUXeI6rSD4TZosXs9ZqV6lSjf8b8 fZUkf8UNy1MAAmutSOvA4k75RI3Mx63j69qFZeVOAVTgrHKO5YKEyciYAmQxtdkMAG uYXGXoUQvxBNlYVAlVsjdz9Yd3z0CCAtZZd5fFrs4dsyJwgECuP0m3k7fsx5rBN575 HWwa0jTM9lbq4XUMRzpnBDln1zpfNVEgmCNUD1W+4D7qbA9Wp4aGR82oDH52dQz2TD fcQ7XpkZ/e57g== Received: from localhost (trond@localhost) by enterprise.ximalas.info (8.15.2/8.15.2/Submit) with ESMTP id x6JHqr3V032221 for ; Fri, 19 Jul 2019 19:52:53 +0200 (CEST) (envelope-from trond.endrestol@ximalas.info) X-Authentication-Warning: enterprise.ximalas.info: trond owned process doing -bs Date: Fri, 19 Jul 2019 19:52:53 +0200 (CEST) From: =?UTF-8?Q?Trond_Endrest=C3=B8l?= Sender: Trond.Endrestol@ximalas.info To: FreeBSD Mailing List Subject: Re: poudriere: build one package (accept license) In-Reply-To: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> Message-ID: References: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> User-Agent: Alpine 2.21.99999 (BSF 352 2019-06-22) OpenPGP: url=http://ximalas.info/about/tronds-openpgp-public-key MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII X-Spam-Status: No, score=-1.2 required=5.0 tests=ALL_TRUSTED,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,DKIM_VALID_EF autolearn=unavailable autolearn_force=no version=3.4.2 X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on enterprise.ximalas.info X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 17:53:01 -0000 On Fri, 19 Jul 2019 12:17-0500, Valeri Galtsev wrote: > Ignored: License DCC needs confirmation, but BATCH is defined If we're talking about mail/dcc-dccd, then try LICENSES_ACCEPTED+=DCC in /etc/make.conf or a similar file. I actually created /usr/ports/mail/dcc-dccd/Makefile.local and placed the line there years ago. -- Trond. From owner-freebsd-questions@freebsd.org Fri Jul 19 18:03:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 86765A843D for ; Fri, 19 Jul 2019 18:03:08 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 6881477FD0 for ; Fri, 19 Jul 2019 18:03:08 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from point.uchicago.edu (point.uchicago.edu [128.135.52.6]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 2C33D4E632; Fri, 19 Jul 2019 13:03:02 -0500 (CDT) Subject: Re: poudriere: build one package (accept license) To: =?UTF-8?Q?Trond_Endrest=c3=b8l?= , FreeBSD Mailing List References: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> From: Valeri Galtsev Message-ID: <87d62669-9cb7-a0b7-1329-f56d26ecc7fe@kicp.uchicago.edu> Date: Fri, 19 Jul 2019 13:03:01 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 6881477FD0 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [-6.97 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; REPLY(-4.00)[]; NEURAL_HAM_SHORT(-0.97)[-0.974,0] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 18:03:08 -0000 On 2019-07-19 12:52, Trond Endrestøl wrote: > On Fri, 19 Jul 2019 12:17-0500, Valeri Galtsev wrote: > >> Ignored: License DCC needs confirmation, but BATCH is defined > > If we're talking about mail/dcc-dccd, then try > > LICENSES_ACCEPTED+=DCC > > in /etc/make.conf or a similar file. > > I actually created /usr/ports/mail/dcc-dccd/Makefile.local and placed > the line there years ago. > Thank you, Trond! You saved my day (the whole week actually!) Valeri -- ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Fri Jul 19 22:29:08 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 226C2AD378 for ; Fri, 19 Jul 2019 22:29:08 +0000 (UTC) (envelope-from dave.mehler@gmail.com) Received: from mail-wm1-x32e.google.com (mail-wm1-x32e.google.com [IPv6:2a00:1450:4864:20::32e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 77A6488686 for ; Fri, 19 Jul 2019 22:29:07 +0000 (UTC) (envelope-from dave.mehler@gmail.com) Received: by mail-wm1-x32e.google.com with SMTP id g67so26197460wme.1 for ; Fri, 19 Jul 2019 15:29:07 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=feaiaiVFiZWtuYEtsjHeGhJ6NXodn6cOp32nOplQoQA=; b=eI1lCXSxMfHMiOtMpef5oC5B+NFLwD59owZ8uj0VZouEDvwBTiX5nu81Skn1DVWU7R ksR+j2XUCbBgUNh7RSHPlxh12lZxiTYP+ZuLg9sveYralTqMW14hNwvS1zaaTJyAEyt+ NwnYZ8MDhk6LhD7RmBIGcD7w6ckYl9ODeHHcMkKmqZbkIxIKXiVqviPnIe59CQKOXfqJ fV6G5hQKYoc6ygbbTNimajhRU4c6MEBb86KeAnURSDcxrK7lsm+CJ+cnrpaB7p7yK513 3RFJ9/R7c9kPmW1TRJQHAbI7jNv3Qh+GXof6BnSV9Y/RiFmaYs5HTXWg52ntExKtSjFA R5Bg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=feaiaiVFiZWtuYEtsjHeGhJ6NXodn6cOp32nOplQoQA=; b=cIqtApdimrnZoj+FAEGG6B8ilAgrfHk5MZK0pwf05rkwtH4KFOKCxhEyEwSpPnHpKO Mpoki1ZDzx5X9Z26b/zyvG/lFQHYRe0O699uqJU8olVbA4Z1PYrxvDAE/ib7J6Jf4gQc l/Z33zHM3b1HAlQCTt0hsVMgxK2IzGtOekzESxQvewuLe5hZkcPQ6wtE6NnsGesrBsXF Jk9ZYLKLAYpsP10DWVF1p/Y3W3nE30ohYzZgEW332P8p+NW0Nx/eIbTxDJWKtphLHvz9 75CY8FNiT93IajeVydWbRaLVZpdAl79trLAi0NF/X967k+FNTwVBtL7lKtQTJrAAcDnl /WQg== X-Gm-Message-State: APjAAAXVukHNogq4MHvj0WMN4bUO6LA+kBIiXjfX6OtZzL9ptdrpAh37 pnJ1W89N+7v+7BNPInQ0zPlv6pTE0WZhCllVM7yDekVu X-Google-Smtp-Source: APXvYqzNwu8nvTjTVqNaOCI7p4CipqP5wCxZq5hbPygUREtwupa7LcWzR6bDOYhluNsC5HMJsPKi7pxDlOOstKRVHes= X-Received: by 2002:a05:600c:23d2:: with SMTP id p18mr48234645wmb.108.1563575346023; Fri, 19 Jul 2019 15:29:06 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:adf:f011:0:0:0:0:0 with HTTP; Fri, 19 Jul 2019 15:29:05 -0700 (PDT) From: David Mehler Date: Fri, 19 Jul 2019 18:29:05 -0400 Message-ID: Subject: running poudriere in a jail To: freebsd-questions Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 77A6488686 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=eI1lCXSx; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of davemehler@gmail.com designates 2a00:1450:4864:20::32e as permitted sender) smtp.mailfrom=davemehler@gmail.com X-Spamd-Result: default: False [-6.86 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; NEURAL_HAM_SHORT(-0.91)[-0.909,0]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(-2.94)[ip: (-9.27), ipnet: 2a00:1450::/32(-2.93), asn: 15169(-2.43), country: US(-0.05)]; RCVD_IN_DNSWL_NONE(0.00)[e.2.3.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 22:29:08 -0000 Hello, Does anyone have a configuration for 12.0 that runs poudriere in it's own jail? What I mean is I have a jail called portsbuild, and in that jail I'm running poudriere. It is not on the host, yet it is giving me problems, host loaded modules, and it's saying jail.set command not allowed. A working configuration is welcome. Thanks. Dave. From owner-freebsd-questions@freebsd.org Fri Jul 19 23:53:43 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 44CDDAF085 for ; Fri, 19 Jul 2019 23:53:43 +0000 (UTC) (envelope-from eduardo.lemosdesa@gmail.com) Received: from mail-lj1-x233.google.com (mail-lj1-x233.google.com [IPv6:2a00:1450:4864:20::233]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 25EC98C4B2 for ; Fri, 19 Jul 2019 23:53:42 +0000 (UTC) (envelope-from eduardo.lemosdesa@gmail.com) Received: by mail-lj1-x233.google.com with SMTP id i21so32284658ljj.3 for ; Fri, 19 Jul 2019 16:53:42 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=3Ef4IqExYQweMqZAQtqfO08ALyjRS3suhSFGCwz3GfA=; b=OCHlhtCSFSQ7Ro/vgnsEbstEAXy7FqeCMct+pKo/XThVjjVQiblliP3SU7ismf7PVs V3inizMdRXf5DLu5dFlixpEypx7xEMo18q7Aq0v5pWge7wiJheAr7JvicIGkVDF6v/So OOV34L1taL61WUoSi9pHdgHckyOZKA96g892zCWrz8YTRCCzi6uVXpx7XmFP43cntAAD XDm3nx2ji2l80zpGt05YGglMIMB1j96mFsWtGLN0a92EDiK17FkDLdPMPa7rCVNkvKxa 8wmASuKgpj5KIqOUkmNxgW07b+nigSb1BhYgz5HlyqhOlrb/10w7+7TYBUFaAJBmErtG Uy0g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=3Ef4IqExYQweMqZAQtqfO08ALyjRS3suhSFGCwz3GfA=; b=eIdNPx64/Ul9rxA0zi+5mq94t23kuneFHlIg9NP6j8jwABu5cspriy6wgqtaBy1ip9 qaRedCbwZ0Farqb/JiMpt/CcZDX38yXHriebt/1gjzITQFNWcm3XukJeMIE27aTsDkKG 47W6vMw0YRdT+fmVOLM/HUwv6OzI//t0sLKCBkmo+KsPSKLEymVNE3CeBOh1MNy0DNUk wIiW/Dj+phBIm2lwaYOB4IqISjOy4QZWI3vRtqjkr1UCM036tWQevuDKI8RNa7DxAf0t 23uR50sUJ6vUZmHfrEpmn2G94UeBa7/1GamvvojoOPtQaNc2E35NzuYqrcZ0Z/z0cM1I NssA== X-Gm-Message-State: APjAAAXCMZmhyhAKHzJixK2uQdEVSwNsGOAGzxrIjtEgiuPThAWiVb4U nBpNNhTlwLrP8qYQRVVS195luwkkr9BF8vkb2qQ= X-Google-Smtp-Source: APXvYqwd8F7cbHm8y06/PiBBbypZE5plMHge7wag/0yAE13WeUyMU66Au6XuzptmydPmfVZdtEk7ua9kjYZSoIOjAko= X-Received: by 2002:a2e:88d3:: with SMTP id a19mr29356905ljk.32.1563580420483; Fri, 19 Jul 2019 16:53:40 -0700 (PDT) MIME-Version: 1.0 References: <100.908e0e00be82305d.007@88watts.net> <5d30cea3.1c69fb81.db177.dcf9SMTPIN_ADDED_MISSING@mx.google.com> In-Reply-To: <5d30cea3.1c69fb81.db177.dcf9SMTPIN_ADDED_MISSING@mx.google.com> From: Eduardo Lemos de Sa Date: Fri, 19 Jul 2019 20:53:29 -0300 Message-ID: Subject: Re: Cannot build generic kernel To: Thomas Mueller Cc: "freebsd-questions@FreeBSD.org" X-Rspamd-Queue-Id: 25EC98C4B2 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=OCHlhtCS; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of eduardolemosdesa@gmail.com designates 2a00:1450:4864:20::233 as permitted sender) smtp.mailfrom=eduardolemosdesa@gmail.com X-Spamd-Result: default: False [-6.92 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.98)[-0.979,0]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FREEMAIL_TO(0.00)[twc.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[3.3.2.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.5.4.1.0.0.a.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-2.93)[ip: (-9.24), ipnet: 2a00:1450::/32(-2.94), asn: 15169(-2.43), country: US(-0.05)]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Jul 2019 23:53:43 -0000 Dear On Thu, Jul 18, 2019 at 4:55 PM Thomas Mueller wrote: > from David Azarewicz: > > > I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img > > > I checked out base/stable/12 r350009 using svnlite > > > I followed the directions on > https://www.freebsd.org/doc/handbook/kernelconfig-building.html > > for building the kernel. > > > I get an error: > > make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 > kernel requires linker > > ifunc support > > > both > > make buildkernel > > and > > make buildkernel KERNCONF=3DGENERIC > > fail exactly the same way. > > > Today I updated to r350112 and the problem persists. > > > So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a > fresh unmodified > > checkout of FreeBSD 12 stable, I followed the directions for building > the standard, default, > > generic kernel and it fails. I tried searching for a solution to this > problem and could not find a > > solution. How can I fix this problem? > > Did you make buildworld before attempting buildkernel? > > I read UPDATING in the top directory of the src tree, and you are suppose= d > to "make buildworld" before buildkernel. > > That would put updated tools in place for buildkernel. > > Tom > > No, I just make kernel-toolchain buildkernel make installkernel reboot make buildworld make installworld (sometimes, you need to do a mergemaster -Ui - as it is described on handbook) Cheers Eduardo _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > --=20 Eduardo Lemos de Sa Professor Titular Dep. Quimica da Universidade Federal do Paran=C3=A1 fone: +55(41)3361-3300 fax: +55(41)3361-3186 From owner-freebsd-questions@freebsd.org Sat Jul 20 03:48:39 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 06311B396D for ; Sat, 20 Jul 2019 03:48:39 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.126.131]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id D12E26B767 for ; Sat, 20 Jul 2019 03:48:35 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([178.12.119.142]) by mrelayeu.kundenserver.de (mreue012 [212.227.15.167]) with ESMTPA (Nemesis) id 1N8EdM-1iSGOb2m5A-014BSx; Sat, 20 Jul 2019 05:48:21 +0200 Date: Sat, 20 Jul 2019 05:48:18 +0200 From: Polytropon To: Eduardo Lemos de Sa Cc: Thomas Mueller , "freebsd-questions@FreeBSD.org" Subject: Re: Cannot build generic kernel Message-Id: <20190720054818.055363f0.freebsd@edvax.de> In-Reply-To: References: <100.908e0e00be82305d.007@88watts.net> <5d30cea3.1c69fb81.db177.dcf9SMTPIN_ADDED_MISSING@mx.google.com> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:JDFMFUtEuxcLXsSUwhyCmWOD6V5beIRZx5z8YYYLAgnRj1+/Pj0 mdd7jAm3PHQ/o6ysY6mbNpR8QSGNrLD3sFH279McQIjf+rDl8U28DEgEHXBDKQyiGExcXUI P23IKP58YPVw6207UH1/roR5j1yoLtjrNGTdJvuWpqYYblMFuNnUbScQjf5H7tamj3/jf3/ AJ564mthGzn2vSm8341yQ== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:9ikEtmzb3Io=:FLocWywU4iygrX5mQEIz5z VwFna568QPx6vn20VJax3gc/TajkzeTMtE/slHxPSGoioYuG1kU5SczVtoUOq5tway8GLx7Cx 7QxjnE6ui7K8pRvXVh9sAUC4k2TxHeeu+F5ClN5806bY6L/r2ZXKTdHn99wxegKgXv/TnHnZL zS5jFR19K29cOLMja+HE0A/j+hxwITqla8xdI0FSjyWrK0ocIdEoL77pPtcHWuyXSvaBID6sv sgCAg5IeQi1PbqDa071jMLsgAo3RYDugL1cGbDHvwkYGrbqfsybVGKC0CXBi5YW2tCgIaCPNA hchv7RpsxyUqoMWQjwsDO//rgDo3aC51pZM9wfBVTsbl/+Y4SXOSrb+LEj3oCegN1RluF92xt XM4kJNJUFP+kFTBIObW9KsU5cBWwtjUghYNbF9iq8leQKeIj1T7oPeVFHd/daEhHYwVBnGTCW inTORO0LawSakusawX7eVu9tc/Ig0oCTHedlJzCJVSw+AJlrdZB7nJ3KKMU6Ytsy07b3/Uy6N OwEtMhxvQmMz8vKf54nWMaW9YQSOTXfbpJnV+2K2oWYQRtqPXgMDcvl1jzo+UByxD0EpcuAfr 8Pu3BQudfqGz1tfPNT3yePyngvjITllPhAFuTBIDg3B3WVDUW4S67MVjCxUjtaNAoycrG+3Iz MGRt0aCfRDHtbH6qdrDcbFYpJXeCsXEDOqNnFNuHcXjBxr6yh4avcGII5Lw0ny5Yt4hwB+eN2 yj8SALNOHg7rizeBvDxIdcYyJ6BugrwpG0qpVemt/TXGSy9zRuI99oyTHgc= X-Rspamd-Queue-Id: D12E26B767 X-Spamd-Bar: +++++ Authentication-Results: mx1.freebsd.org X-Spamd-Result: default: False [5.91 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; MX_GOOD(-0.01)[mx00.schlund.de,mx01.schlund.de]; FREEMAIL_TO(0.00)[gmail.com]; RECEIVED_SPAMHAUS_PBL(0.00)[142.119.12.178.zen.spamhaus.org : 127.0.0.11]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(0.98)[0.976,0]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(0.97)[0.972,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000,0]; RCVD_IN_DNSWL_NONE(0.00)[131.126.227.212.list.dnswl.org : 127.0.5.0]; MID_CONTAINS_FROM(1.00)[]; R_SPF_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FREEMAIL_CC(0.00)[twc.com]; IP_SCORE(0.58)[ip: (1.93), ipnet: 212.227.0.0/16(-1.41), asn: 8560(2.38), country: DE(-0.01)] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Jul 2019 03:48:39 -0000 On Fri, 19 Jul 2019 20:53:29 -0300, Eduardo Lemos de Sa wrote: > Dear > > On Thu, Jul 18, 2019 at 4:55 PM Thomas Mueller wrote: > > > from David Azarewicz: > > > > > I downloaded and installed FreeBSD-12.0-RELEASE-i386-memstick.img > > > > > I checked out base/stable/12 r350009 using svnlite > > > > > I followed the directions on > > https://www.freebsd.org/doc/handbook/kernelconfig-building.html > > > for building the kernel. > > > > > I get an error: > > > make[2]: "/usr/src/sys/conf/kern.pre.mk" line 127: amd64/arm64/i386 > > kernel requires linker > > > ifunc support > > > > > both > > > make buildkernel > > > and > > > make buildkernel KERNCONF=GENERIC > > > fail exactly the same way. > > > > > Today I updated to r350112 and the problem persists. > > > > > So I have a fresh unmodified install of FreeBSD 12.0 RELEASE, I have a > > fresh unmodified > > > checkout of FreeBSD 12 stable, I followed the directions for building > > the standard, default, > > > generic kernel and it fails. I tried searching for a solution to this > > problem and could not find a > > > solution. How can I fix this problem? > > > > Did you make buildworld before attempting buildkernel? > > > > I read UPDATING in the top directory of the src tree, and you are supposed > > to "make buildworld" before buildkernel. > > > > That would put updated tools in place for buildkernel. > > > > Tom > > > > > No, I just > > > make kernel-toolchain buildkernel > > make installkernel > > reboot > > make buildworld > > make installworld The step "make buildworld", being required for "make installworld", seems to be missing... > (sometimes, you need to do a mergemaster -Ui - as it is described on > handbook) I suggest you also have a look at /usr/src/Makefile's comment header which contains a nice summary of the procedure you should follow. # For individuals wanting to upgrade their sources (even if only a # delta of a few days): # # 1. `cd /usr/src' (or to the directory containing your source tree). # 2. `make buildworld' # 3. `make buildkernel KERNCONF=YOUR_KERNEL_HERE' (default is GENERIC). # 4. `make installkernel KERNCONF=YOUR_KERNEL_HERE' (default is GENERIC). # [steps 3. & 4. can be combined by using the "kernel" target] # 5. `reboot' (in single user mode: boot -s from the loader prompt). # 6. `mergemaster -p' # 7. `make installworld' # 8. `make delete-old' # 9. `mergemaster' (you may wish to use -i, along with -U or -F). # 10. `reboot' # 11. `make delete-old-libs' (in case no 3rd party program uses them anymore) # # See src/UPDATING `COMMON ITEMS' for more complete information. Compare with the relevant handbook article: https://www.freebsd.org/doc/handbook/makeworld.html Additionally see 23.5.6.2. Checking for Outdated Files and Libraries. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Sat Jul 20 06:57:35 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C0E5BB6601 for ; Sat, 20 Jul 2019 06:57:35 +0000 (UTC) (envelope-from stringchopper@gmail.com) Received: from mail-pf1-x42e.google.com (mail-pf1-x42e.google.com [IPv6:2607:f8b0:4864:20::42e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 894D86FD0F for ; Sat, 20 Jul 2019 06:57:34 +0000 (UTC) (envelope-from stringchopper@gmail.com) Received: by mail-pf1-x42e.google.com with SMTP id r7so15108773pfl.3 for ; Fri, 19 Jul 2019 23:57:34 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=9K9Z412ybfDql5u6aMXOPhvqIUV+uE97Hv+r5uxi8GM=; b=T4e+gY12+rKz1YDvcavO19ubzZqQNpwPLiO6VFFYBQ0RcH3WXzFfRBQVkAKy2Cu9fa 7C6HmdP7plQyUe1L3OPNunDqQ5nin4He8Ln07SaXAA4Ljg4WUA4MvKLing/PsCZir33d kcg/Lta9D5cdA/I/oJUIo00jVIISNWPGnxUijus/d1pkKywcLl5ClagkD9b0pg26QjAn mCih18CL+JdCCLCLnb8g6AOzSYGvkV7WuzVjwuVkCHOEXWs2Ux6Fyjqwl54a312mOuRY +6GQvYzgZWq3aoSRpLieIlN3Orjb943jQc1dmuxwdL6uRTzTzTB1GYzi/OmDMc3k65rG CaYw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=9K9Z412ybfDql5u6aMXOPhvqIUV+uE97Hv+r5uxi8GM=; b=YLsnT83DEgUxf1oSyXvpmq0BHccFoXybSaMKO8f61/fERHizfDgJOPasfxQUlN2XzM VM7yu4/qE5wtby0+viyCVxu2R/fqk/80/MgLM3Tb8GeHDep6ykjD0rBh6A2rF6RDI0f/ mbq/ufpqUcLwtI1+d0iZf7GOG5IDlDx69jjOUGPlkyPXjg/51stL5lvz0UjiCQhhXx4g 10mFghoV/TQIMvqK+OKgl9AEkR6s7TVh+7KmBFOtiU00JJfvwRfskIP6Fg6SxlaNh+Mu tNrSKT/n6T1I/GysP6DlWIXt3XzSNREKgL2qWe3tkgLHfl7dHHU6FAd/CgAr/ewuD624 ES0w== X-Gm-Message-State: APjAAAVf2hVx83rbtNuq/EiZ5TaOtBdyZf9nttWQw44cal+2SAz/+SSb FFGuaEmdzGxkcZOwgTR72vnntPrCo8uq3RH8K8c= X-Google-Smtp-Source: APXvYqy3Sg83RjLDlrK27xKiW2apc/J7pGAzpjjYMMqgOQ3BYN7eUq0bTlWxSvoDZAKJI8Ro5jFb6vLwz2m1SaUG+Fk= X-Received: by 2002:a17:90a:8a91:: with SMTP id x17mr62783492pjn.95.1563605852756; Fri, 19 Jul 2019 23:57:32 -0700 (PDT) MIME-Version: 1.0 References: <23857.61286.9721.989244@alice.local> In-Reply-To: <23857.61286.9721.989244@alice.local> From: Brian Phillips Date: Sat, 20 Jul 2019 02:56:56 -0400 Message-ID: Subject: Re: .emacs error in developer's handbook (section 2.7) standard-display-european & cannot load hilit19 To: hartzell@alerce.com Cc: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 894D86FD0F X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=T4e+gY12; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of stringchopper@gmail.com designates 2607:f8b0:4864:20::42e as permitted sender) smtp.mailfrom=stringchopper@gmail.com X-Spamd-Result: default: False [-5.90 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; MX_GOOD(-0.01)[cached: alt3.gmail-smtp-in.l.google.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.95)[-0.953,0]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; URI_HIDDEN_PATH(1.00)[https://github.com/sjrmanning/.emacs.d]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[e.2.4.0.0.0.0.0.0.0.0.0.0.0.0.0.0.2.0.0.4.6.8.4.0.b.8.f.7.0.6.2.list.dnswl.org : 127.0.5.0]; IP_SCORE(-2.93)[ip: (-9.05), ipnet: 2607:f8b0::/32(-3.13), asn: 15169(-2.43), country: US(-0.05)]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Jul 2019 06:57:35 -0000 Brian Paul Phillips Thank you both for your input. I deleted the lines for hilit and standard-display-european, and emacs opens without error warnings. I will give sjrmanning's config a try and read up on the emacs faq. Good to know about the 'customize' facility for modifying .emacs files. On Fri, Jul 19, 2019 at 12:27 PM George Hartzell wrote: > Brian Phillips writes: > > I'm trying to use the .emacs configuration listed in the FreeBSD > > Developer's Handbook, 2.7, and I get these error messages for which > google > > isn't helping (this neophyte) much. Can someone point me in the right > > direction for fixing the 'standard-display-european' issue as well as > the > > 'cannot open load file ... hilit19' problem? > > Looks like that section of the handbook is fairly out of date. > > Question 66 in the emacs FAQ [1] says that it's deprecated but > included; I don't even see it in the current distributions. The same > FAQ question goes to describe how to use font-lock mode instead. > > If you're looking for a good place to get started with a fancier emacs > config, I found sjrmanning's config [2] to be a wonderful starting > point. > > g. > > [1]: http://www.faqs.org/faqs/GNU-Emacs-FAQ/part2/ > [2]: https://github.com/sjrmanning/.emacs.d > From owner-freebsd-questions@freebsd.org Sat Jul 20 15:40:03 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7BBA1C0F59 for ; Sat, 20 Jul 2019 15:40:03 +0000 (UTC) (envelope-from vas@mpeks.tomsk.su) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 2E2AC86235 for ; Sat, 20 Jul 2019 15:40:02 +0000 (UTC) (envelope-from vas@mpeks.tomsk.su) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=JF99QBsASrCgGH3w4WGvceBPcaDfyWLOsjpDhyUFdzY=; b=Oh8+huTe8diQDpfHEU9ymGVEEQ P8NxFRYlm+9AlCSPsKLICf+oA5uaF28OirgovO3MJGGTZzvKK1ni9zPZgDGfxVbRjcrPCn1W2NuUX lOXq10xqJZtOVN+JaKwodZcSMz/+WTzq0YnqAuXzZnuG5PJPl6PESZvALg89SEie67uY=; Received: from vas by admin.sibptus.ru with local (Exim 4.92 (FreeBSD)) (envelope-from ) id 1horSq-000DgS-Nv for freebsd-questions@freebsd.org; Sat, 20 Jul 2019 22:40:00 +0700 Date: Sat, 20 Jul 2019 22:40:00 +0700 From: Victor Sudakov To: freebsd-questions@freebsd.org Subject: Re: poudriere: build one package (accept license) Message-ID: <20190720154000.GA52569@admin.sibptus.ru> References: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="7JfCtLOvnd9MIVvH" Content-Disposition: inline In-Reply-To: <67ccf18b-3bd6-6a00-bebe-761cb1500208@astro.uchicago.edu> X-PGP-Key: http://www.dreamwidth.org/pubkey?user=victor_sudakov X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 User-Agent: Mutt/1.12.1 (2019-06-15) Sender: Victor Sudakov X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Jul 2019 15:40:03 -0000 --7JfCtLOvnd9MIVvH Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Valeri Galtsev wrote: >=20 > After several years if seamlessly using poudriere, I hit the snag I can= =20 > not resolve myself. >=20 > One of the packages requires to accept license the moment it is built.=20 > When I do >=20 > poudriere bulk .... >=20 > podriere just skips the package saying: >=20 > Ignored: License DCC needs confirmation, but BATCH is defined Try setting DISABLE_LICENSES=3Dyes in /usr/local/etc/poudriere.d/make.conf --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --7JfCtLOvnd9MIVvH Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJdMzXQAAoJEA2k8lmbXsY0//kH+gIDVuHvzLrbMwW6Ol+bG6wO yQblkRurVwQjvUX+RFw7O4KljaKnWlXHcWhYzyWI2DSCS4gfOKgr8N/003AKtt1/ eHy5qBcCRsjnizcoGJBvXCJ/6tSgRHnyNEL5Kco3SIGNXGrYd7DxYQGmtffG5j8m yD57QF3sDhSzpnY0nFDchXwmevIaTwJvWSOrTCQJm34jQ5tTAMm47WCd/IEF6wDh fEWlwNkyBq7hJCS0Yz02CWwPRU3SvL5om3Nqoz3Go0hEIXYOycCrVC/ANwfJHhE9 0wwtHyigl/QY1CRYGSF9erGXNQjw8X1MLl/AcdpgxnMoApq8vndlG6qDNr8QiuM= =SOCh -----END PGP SIGNATURE----- --7JfCtLOvnd9MIVvH-- From owner-freebsd-questions@freebsd.org Sat Jul 20 16:09:14 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DAFE9C1634 for ; Sat, 20 Jul 2019 16:09:14 +0000 (UTC) (envelope-from carmel_ny@outlook.com) Received: from NAM02-CY1-obe.outbound.protection.outlook.com (mail-oln040092004092.outbound.protection.outlook.com [40.92.4.92]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 9BAE986EAE for ; Sat, 20 Jul 2019 16:09:12 +0000 (UTC) (envelope-from carmel_ny@outlook.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=outlook.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=2+kLCbM3535h0DQWhpFjt/1Rs+X3H9kGqAE6IAr3bcI=; b=qGBhSfoMREGKnEjkZ6WWN9HMvbtHtqx0RP9YUxhSHiaVs0uenB07G4ffYTJ+qpv+qIxMceb4Oo2mbAoJD8CvYhjPDfjzzLMm3Rp9gNvNI4Ji5aDPLiDvckHbNgzkCsBl76ZmbuW97EdVCCs9p2prct6e3ScoxUyz0waUJVihIZB1yRPxydQewygeqBOS2tJeE9+IjOtpk2Zgixs6MggALUfo2ByhICg0QHFK/tt8vmc7g+Dpg1Iw+fOqXsR5OoPdXQeDmXYhRmiplxcfXbNy3Pxa6bgmk7aybajlolNnttUIdt9taXwMSY50n6dbnSb0uMEVio/UFx4eeCd/k0Vg/A== Received: from CY1NAM02FT052.eop-nam02.prod.protection.outlook.com (10.152.74.53) by CY1NAM02HT117.eop-nam02.prod.protection.outlook.com (10.152.74.72) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2052.25; Sat, 20 Jul 2019 15:53:40 +0000 Received: from MWHPR04MB0495.namprd04.prod.outlook.com (10.152.74.58) by CY1NAM02FT052.mail.protection.outlook.com (10.152.74.123) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2052.25 via Frontend Transport; Sat, 20 Jul 2019 15:53:40 +0000 Received: from MWHPR04MB0495.namprd04.prod.outlook.com ([fe80::4427:c2b6:8908:c1e2]) by MWHPR04MB0495.namprd04.prod.outlook.com ([fe80::4427:c2b6:8908:c1e2%7]) with mapi id 15.20.2094.013; Sat, 20 Jul 2019 15:53:40 +0000 From: Carmel NY To: "freebsd-questions@freebsd.org" Subject: "invalid antenna gain in sprom" Thread-Topic: "invalid antenna gain in sprom" Thread-Index: AQHVPxNMqu/lkQY5QESSgiFjKfd8+A== Date: Sat, 20 Jul 2019 15:53:40 +0000 Message-ID: Reply-To: "freebsd-questions@freebsd.org" Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-clientproxiedby: BN8PR03CA0026.namprd03.prod.outlook.com (2603:10b6:408:94::39) To MWHPR04MB0495.namprd04.prod.outlook.com (2603:10b6:300:73::16) x-mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; i686-w64-mingw32) x-incomingtopheadermarker: OriginalChecksum:E9B4553467AFA02579908162D315047F4B7DBD81993BB3D8D50FE9637690FDD8; UpperCasedChecksum:B81C700F1B12FB8D6A4E8D78F1687212869AAFB0EE337D719995A0838A136545; SizeAsReceived:7402; Count:49 x-ms-exchange-messagesentrepresentingtype: 1 x-tmn: [50V5WmV3BgvUlm/VeIh2+oPfpxQSKjHaXw2IxvLbPMM=] x-microsoft-original-message-id: <20190720115335.00003ade@outlook.com> x-ms-publictraffictype: Email x-incomingheadercount: 49 x-eopattributedmessage: 0 x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(5050001)(7020095)(20181119110)(201702061078)(5061506573)(5061507331)(1603103135)(2017031320274)(2017031322404)(2017031323274)(2017031324274)(1601125500)(1603101475)(1701031045); SRVR:CY1NAM02HT117; x-ms-traffictypediagnostic: CY1NAM02HT117: x-microsoft-antispam-message-info: yWcSL1vhhztKtW2g8LSR1/1apPypiaUPxz2Hqmuyy8iP7dpWcqCmg5rfDPAQ1ihoood81qf/1Anz1ql/f02qRzEdK4dKycEaGKZAIM6SKCLAKv/vxu8EY2aM1IEWgT08LH5JzNQ4maIccVO5mRyPjyUj3Qs/ZT4zF5M62DAFHfYWIlYl7uNwJqXEJPC0b2k2 Content-Type: text/plain; charset="utf-8" Content-ID: Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-OriginatorOrg: outlook.com X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-Network-Message-Id: 5110d07f-d7ca-40b2-e2c4-08d70d2a6eca X-MS-Exchange-CrossTenant-rms-persistedconsumerorg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-CrossTenant-originalarrivaltime: 20 Jul 2019 15:53:40.5751 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Internet X-MS-Exchange-CrossTenant-id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-Transport-CrossTenantHeadersStamped: CY1NAM02HT117 X-Rspamd-Queue-Id: 9BAE986EAE X-Spamd-Bar: ++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=outlook.com header.s=selector1 header.b=qGBhSfoM; dmarc=pass (policy=none) header.from=outlook.com; spf=pass (mx1.freebsd.org: domain of carmel_ny@outlook.com designates 40.92.4.92 as permitted sender) smtp.mailfrom=carmel_ny@outlook.com X-Spamd-Result: default: False [2.04 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; R_SPF_ALLOW(-0.20)[+ip4:40.92.0.0/15]; FREEMAIL_FROM(0.00)[outlook.com]; RCVD_COUNT_THREE(0.00)[4]; MX_GOOD(-0.01)[cached: outlook-com.olc.protection.outlook.com]; DKIM_TRACE(0.00)[outlook.com:+]; MIME_BASE64_TEXT(0.10)[]; NEURAL_HAM_SHORT(-0.15)[-0.151,0]; DMARC_POLICY_ALLOW(-0.50)[outlook.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[outlook.com]; REPLYTO_EQ_TO_ADDR(5.00)[]; RCVD_TLS_LAST(0.00)[]; DWL_DNSWL_NONE(0.00)[outlook.com.dwl.dnswl.org : 127.0.3.0]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.98)[-0.977,0]; R_DKIM_ALLOW(-0.20)[outlook.com:s=selector1]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.92)[-0.921,0]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_ONE(0.00)[1]; RCVD_IN_DNSWL_NONE(0.00)[92.4.92.40.list.dnswl.org : 127.0.3.0]; TO_DN_EQ_ADDR_ALL(0.00)[]; GREYLIST(0.00)[pass,body] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Jul 2019 16:09:14 -0000 SSBqdXN0IGluc3RhbGxlZCBGcmVlQlNEIDEyIG9udG8gYW4gb2xkZXIgUEMsIG1vc3RseSBqdXN0 IHRvIHBsYXkNCmFyb3VuZCB3aXRoIGl0LiBBbnl3YXksIHVwb24gYm9vdCB1cCBJIGFtIHByZXNl bnRlZCB3aXRoIHRoaXMgbWVzc2FnZToNCg0KQXV0b2xvYWRpbmcgbW9kdWxlOiBpZl9id2kua28g ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICANCkF1dG9s b2FkaW5nIG1vZHVsZTogaWZfYnduLmtvICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgDQpid2kwOiA8QnJvYWRjb20gQkNNNDMxOCA4MDIuMTFiL2cgV2ly ZWxlc3MgTGFuPiBtZW0gMHhmZGVmZTAwMC0weGZkZWZmZmZmIGlycSAxNg0KIGF0IGRldmljZSAx LjAgb24gcGNpMiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICANCmJ3aTA6IEJCUDogaWQgMHg0MzE4LCByZXYgMHgyLCBwa2cgMCAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgDQpid2kwOiBNQUM6IHJldiA5ICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgIA0KYndpMDogUEhZOiB0eXBlIDIsIHJldiA3LCB2ZXIgMyAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICANCmJ3aTA6IFJGOiBtYW51IDB4MTdmLCB0eXBl IDB4MjA1MCwgcmV2IDggICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgDQpi d2kwOiBpbnZhbGlkIGFudGVubmEgZ2FpbiBpbiBzcHJvbSAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgIA0KQ29uZmlndXJpbmcgdnQ6IGtleW1hcC4gICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICANCkF1dG9sb2Fk aW5nIG1vZHVsZTogdWhpZC5rbyAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgDQpBdXRvbG9hZGluZyBtb2R1bGU6IHVtcy5rbw0KDQpJIGhhdmUgbm90 IGJlZW4gYWJsZSB0byBnZXQgdGhlIHdpcmVsZXNzIGNhcmQgdG8gd29yaywgYWx0aG91Z2ggSSBr bm93DQp0aGF0IGl0IGRvZXMgYmVjYXVzZSBJIGhhZCBXaW5kb3dzIDEwIHJ1bm5pbmcgb24gdGhp cyBQQy4gSSBhbHNvIGhhdmUNCm5vIGlkZWEgd2hhdCB0aGUgImludmFsaWQgYW50ZW5uYSBnYWlu IGluIHNwcm9tJyBtZWFucy4gR29vZ2xpbmcgaXQgaGFzDQpub3QgcHJvZHVjZWQgYSBsb3Qgb2Yg dXNlZnVsIGRhdGEuIEkgYW0ganVzdCB3b25kZXJpbmcgaWYgYW55b25lIGhhcw0KZ290dGVuIHRo aXMgY2FyZCB0byB3b3JrIGFuZCBwb3NzaWJsZSwgd2hhdCB0aGUgJ3Nwcm9tJyB3YXJuaW5nIGlz IGFsbA0KYWJvdXQuDQoNCi0tIA0KQ2FybWVsDQo= From owner-freebsd-questions@freebsd.org Sat Jul 20 17:34:17 2019 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 655F7C349C for ; Sat, 20 Jul 2019 17:34:17 +0000 (UTC) (envelope-from inv@ui.prato.it) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 2CD8889DC7 for ; Sat, 20 Jul 2019 17:34:17 +0000 (UTC) (envelope-from inv@ui.prato.it) Received: by mailman.nyi.freebsd.org (Postfix) id 2A47CC3499; Sat, 20 Jul 2019 17:34:17 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2A04CC3498 for ; Sat, 20 Jul 2019 17:34:17 +0000 (UTC) (envelope-from inv@ui.prato.it) Received: from zimbra.ui.prato.it (zimbra.ui.prato.it [93.188.112.40]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 759BA89DC5 for ; Sat, 20 Jul 2019 17:34:16 +0000 (UTC) (envelope-from inv@ui.prato.it) Received: from localhost (localhost.localdomain [127.0.0.1]) by zimbra.ui.prato.it (Postfix) with ESMTP id E0EEDF022F1 for ; Sat, 20 Jul 2019 19:34:14 +0200 (CEST) Received: from zimbra.ui.prato.it ([127.0.0.1]) by localhost (zimbra.ui.prato.it [127.0.0.1]) (amavisd-new, port 10032) with ESMTP id GuhTbaik0A1I for ; Sat, 20 Jul 2019 19:34:14 +0200 (CEST) Received: from localhost (localhost.localdomain [127.0.0.1]) by zimbra.ui.prato.it (Postfix) with ESMTP id 0ACC3F031C8 for ; Sat, 20 Jul 2019 19:26:27 +0200 (CEST) DKIM-Filter: OpenDKIM Filter v2.10.3 zimbra.ui.prato.it 0ACC3F031C8 X-Virus-Scanned: amavisd-new at ui.prato.it Received: from zimbra.ui.prato.it ([127.0.0.1]) by localhost (zimbra.ui.prato.it [127.0.0.1]) (amavisd-new, port 10026) with ESMTP id fu2tsRFdpdKs for ; Sat, 20 Jul 2019 19:26:26 +0200 (CEST) Received: from WIN-HUAKD8TBG21.local (unknown [185.242.180.120]) by zimbra.ui.prato.it (Postfix) with ESMTPSA id C921FF0395E for ; Sat, 20 Jul 2019 19:18:23 +0200 (CEST) From: "=?utf-8?B?QnVkZ2V0IENsZWFuZXJzIMKu?=" To: questions@freebsd.org Subject: Budget Cleaners Tax Invoice Date: Sat, 20 Jul 2019 17:18:23 +0200 MIME-Version: 1.0 Message-ID: <156353811362e48b9bb52f82ada8125da0076b8bbe_63788@ui.prato.it> X-Rspamd-Queue-Id: 759BA89DC5 X-Spamd-Bar: + X-Spamd-Result: default: False [1.77 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[ui.prato.it:s=0606D86E-3EFD-11E7-BD6F-3E499311674D]; RCVD_COUNT_FIVE(0.00)[6]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/related,multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; TO_DN_NONE(0.00)[]; NEURAL_SPAM_MEDIUM(1.00)[0.998,0]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-0.72)[-0.715,0]; IP_SCORE(0.31)[ip: (0.81), ipnet: 93.188.112.0/21(0.41), asn: 47178(0.33), country: IT(0.03)]; NEURAL_SPAM_SHORT(0.85)[0.845,0]; DKIM_TRACE(0.00)[ui.prato.it:+]; DMARC_POLICY_ALLOW(-0.50)[ui.prato.it,quarantine]; RCVD_IN_DNSWL_NONE(0.00)[40.112.188.93.list.dnswl.org : 127.0.10.0]; MX_GOOD(-0.01)[cached: ns1.conmet.it]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:47178, ipnet:93.188.112.0/21, country:IT]; PHISHING(1.34)[sageone.co->inv231.s3.ca-central-1.amazonaws.com]; MID_RHS_MATCH_FROM(0.00)[] Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Jul 2019 17:34:17 -0000 You have received an Invoice Budget Cleaners from Budget Cleaners =09 =09 View your invoice online: https://accounting.sageone.co.za/customerzone/invoice/viewinvoice?TypeId= =3D1&Key=3Dffd62228-a6b3-4a8a-bb26-2ca3c5165bba&T=3D1&TraceId=3D30491393 Dear Valued Client. Thank You, for using Budget Cleaners, please kindly make payment for your Tax= invoice as stated on the above link. Please Note, all accounts are STRICTLY payable by the 20th of each month,= unless prior arrangements have been made with the Accounts Dept. Thank You. Kind Regards. Budget Cleaners Management. =09 =09 Generated by Accounting =09