From owner-freebsd-ppc@freebsd.org Wed May 27 01:41:44 2020 Return-Path: Delivered-To: freebsd-ppc@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1FE272FA79F for ; Wed, 27 May 2020 01:41:44 +0000 (UTC) (envelope-from corky1951@comcast.net) Received: from resqmta-po-10v.sys.comcast.net (resqmta-po-10v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:169]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 49Wtpt4Brtz4LLf for ; Wed, 27 May 2020 01:41:42 +0000 (UTC) (envelope-from corky1951@comcast.net) Received: from resomta-po-01v.sys.comcast.net ([96.114.154.225]) by resqmta-po-10v.sys.comcast.net with ESMTP id dkOfjS8MQCiludl4fj7bN2; Wed, 27 May 2020 01:41:41 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1590543701; bh=x7AnvMTKzWCleIQ9IATzUszEFG0NP2j+wXybhroeDxw=; h=Received:Received:Subject:From:To:Message-ID:Date:MIME-Version: Content-Type; b=0u9qhnXRJ/939xt+9rPonW2soPV7Kl/lmbfxf687cmR4Iq9CxvBHssLh8wgS6Jytj 6KjfbDMlBifjsO38ACn9fACFG8kXzZxZObcz5L9nrPuJ5021xWAz87SzAm6ZENsXEf fhngcG2ZFbwYOJoNCpgumS45GWxSBS+Lx7rjDmVKxpyK9euHCQ4h3THF9IA38QD7me +OL9GX3twnGYf9ICMkl0xkZsJ5s6Y62bHMBdH9wvaSLle017G4NHUjuNpiMNbV83f2 jWVPScg+BH2PwqfVYsLgpu1ACpXrQ+gKUlwE4j/7cEVgbpQTSb+I2X+nZo4P180r7G dJQ6W8LZFL+ZQ== Received: from [192.168.1.106] ([67.170.125.248]) by resomta-po-01v.sys.comcast.net with ESMTPA id dl4djYtS99e6Ddl4ejLLej; Wed, 27 May 2020 01:41:40 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduhedruddvfedggeejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefuhffvfhfkffgfgggjtgfgsehtkeertddtfeejnecuhfhrohhmpeevhhgrrhhlihgvucfmvghsthgvrhcuoegtohhrkhihudelhedusegtohhmtggrshhtrdhnvghtqeenucggtffrrghtthgvrhhnpeeikeehleehieevvedtveefudduvdffuddtvefhteelueehvdehveekvdeivdekfeenucfkphepieejrddujedtrdduvdehrddvgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheplgduledvrdduieekrddurddutdeingdpihhnvghtpeeijedrudejtddruddvhedrvdegkedpmhgrihhlfhhrohhmpegtohhrkhihudelhedusegtohhmtggrshhtrdhnvghtpdhrtghpthhtohepfhhrvggvsghsugdqphhptgesfhhrvggvsghsugdrohhrghdprhgtphhtthhopegthhhmvggvvggurghlfhesghhmrghilhdrtghomh X-Xfinity-VMeta: sc=0.00;st=legit Subject: RESOLVED: Build failure of gmp-6.2.0 on Mac Mini G4 From: Charlie Kester To: Justin Hibbits Cc: freebsd-ppc@freebsd.org References: <18d93226-7cc6-4cef-1667-f05dea8770a3@comcast.net> <20200526194532.07d637bb@titan.knownspace> <83543ad1-48c9-cf6c-b24b-f47c249a1634@comcast.net> Message-ID: <1afbd7a9-0383-f31b-0c76-36be152a1851@comcast.net> Date: Tue, 26 May 2020 18:41:39 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:68.0) Gecko/20100101 Thunderbird/68.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 49Wtpt4Brtz4LLf X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=comcast.net header.s=20190202a header.b=0u9qhnXR; dmarc=pass (policy=none) header.from=comcast.net; spf=pass (mx1.freebsd.org: domain of corky1951@comcast.net designates 2001:558:fe16:19:96:114:154:169 as permitted sender) smtp.mailfrom=corky1951@comcast.net X-Spamd-Result: default: False [-0.79 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[comcast.net]; R_SPF_ALLOW(-0.20)[+ip6:2001:558:fe16:19:96:114:154:0/112]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[comcast.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[comcast.net,none]; NEURAL_HAM_SHORT(-0.78)[-0.779]; HFILTER_HELO_5(3.00)[resqmta-po-10v.sys.comcast.net]; FREEMAIL_TO(0.00)[gmail.com]; RECEIVED_SPAMHAUS_PBL(0.00)[67.170.125.248:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[comcast.net]; ASN(0.00)[asn:7922, ipnet:2001:558::/29, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[comcast.net:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.02)[-1.022]; R_DKIM_ALLOW(-0.20)[comcast.net:s=20190202a]; RCVD_TLS_LAST(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.989]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2001:558:fe16:19:96:114:154:169:from] X-BeenThere: freebsd-ppc@freebsd.org X-Mailman-Version: 2.1.33 Precedence: list List-Id: Porting FreeBSD to the PowerPC List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 May 2020 01:41:44 -0000 On 5/26/20 6:18 PM, Charlie Kester wrote: > On 5/26/20 6:00 PM, Charlie Kester wrote: >> On 5/26/20 5:45 PM, Justin Hibbits wrote: >>> On Tue, 26 May 2020 15:27:46 -0700 >>> Charlie Kester wrote: >>> >>>> (This is a copy of email sent to the port maintainer.  Re-sending to >>>> this list in case someone familiar with powerpc has already >>>> encountered and resolved this issue.) >>>> >>>> >>>> I'm trying to get FreeBSD running on an old Mac Mini and have hit a >>>> snag with this port, which is a dependency of many others. >>>> >>>> The configure step fails with the following output (I don't have mail >>>> running on the mini yet and am typing this on another machine, >>>> so please disregard any typos.  blank lines = line breaks in output): >>>> --------------------------------------------------------------------- >>>> >>>> ===> gmp-6.2.0 depends on file: /usr/local/bin/makeinfo - found >>>> >>>> ===> Configuring for gmp-6.2.0 >>>> >>>> checking build system type... invalid configuration >>>> 'powerpc7447-unknown-freebsd12.1': machine 'powerpc7447-unknown' not >>>> recognized >>>> >>>> configure: error: /bin/sh ./config.sub >>>> powerpc7447-unknown-freebsd12.1 failed >>>> >>>> etc. >>>> ---------------------------------------------------------------------- >>>> I tried >>>> # make configure CONFIGURE_ARGS=--build=powerpc7447 >>>> and >>>> # make configure CONFIGURE_TARGET=powerpc7447 >>>> >>>> Neither worked.  Same failure. >>>> >>>> Any suggestions on how I can resolve this issue? >>> >>> Where do you get powerpc7447?  The arch is 'powerpc', and you shouldn't >>> need to set anything for the port. If you want to customize for your >>> specific CPU, add the following to /etc/make.conf: >>> >>> CPUTYPE=7450 >>> >> >> I got it from the error message above.  ;-) >> >> This is a vanilla install using the ISO CD image downloaded yesterday >> and installed, followed by a portsnap fetch and portsnap extract. >> I haven't made any edits to /etc/make.conf or changed any other >> settings.  Expected it to work "out of the box" but for some reason it >> doesn't. >> >> Am I correct in assuming that the 7447 came as a result of the kernel >> reading the PVR at some point?  Or is this due to the gmp port's own >> attempt to get the processor version in config.guess?  How can I >> confirm which of 7447 or 7450 is correct? > > sysctl reports hw.model as "Motorola PowerPC 7447A" > > So I tried adding CPUTYPE=7447 to /etc/make.conf > > cd /usr/ports/math/gmp > make distclean > make install clean > > Same failure as above ("invalid configuration") > I was finally able to get this port configured and built with: make configure CONFIGURE_ARGS=--build=powerppc Should have tried that sooner. Sorry for the noise. >  -- charlie